Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Interleukin-4 receptor subunit alpha(IL4R)

  • PX-P4860-50
  • Validated ELISA
Host species:
Mammalian cells
Uniprot ID:
P24394
Molecular weight:
27.3kDa

Original price was: €311.00.Current price is: €259.00.

50ug 17% OFF + 259 loyalty points
Met1–His232 His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Interleukin-4 receptor subunit alpha(IL4R)

Product name Interleukin-4 receptor subunit alpha(IL4R)
Uniprot ID P24394
Uniprot link https://www.uniprot.org/uniprot/P24394
Expression system Eukaryotic expression
Raw Antigen Sequence MGWLCSGLLFPVSCLVLLQVASSGNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH
Molecular weight 27.3kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-His232
Protein Accession P24394
Spec:Entrez GeneID 3566
Spec:NCBI Gene Aliases CD124; IL4RA; IL-4RA
Spec:SwissProtID Q96P01
NCBI Reference P24394
Aliases /Synonyms IL4RA,IL-4 receptor subunit alpha,IL-4R subunit alpha,IL-4R-alpha,IL-4RA,CD_antigen: CD124
Reference PX-P4860
Note For research use only
Molecular Constructor
Met1–His232 His
Product name Interleukin-4 receptor subunit alpha(IL4R)
Uniprot ID P24394
Uniprot link https://www.uniprot.org/uniprot/P24394
Expression system Eukaryotic expression
Raw Antigen Sequence MGWLCSGLLFPVSCLVLLQVASSGNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH
Molecular weight 27.3kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-His232
Protein Accession P24394
Spec:Entrez GeneID 3566
Spec:NCBI Gene Aliases CD124; IL4RA; IL-4RA
Spec:SwissProtID Q96P01
NCBI Reference P24394
Aliases /Synonyms IL4RA,IL-4 receptor subunit alpha,IL-4R subunit alpha,IL-4R-alpha,IL-4RA,CD_antigen: CD124
Reference PX-P4860
Note For research use only
Molecular Constructor
Met1–His232 His
Product name PX-P4860-1MG
Uniprot ID P24394
Uniprot link https://www.uniprot.org/uniprot/P24394
Expression system Eukaryotic expression
Raw Antigen Sequence MGWLCSGLLFPVSCLVLLQVASSGNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH
Molecular weight 27.3kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-His232
Protein Accession P24394
Spec:Entrez GeneID 3566
Spec:NCBI Gene Aliases CD124; IL4RA; IL-4RA
Spec:SwissProtID Q96P01
NCBI Reference P24394
Aliases /Synonyms IL4RA,IL-4 receptor subunit alpha,IL-4R subunit alpha,IL-4R-alpha,IL-4RA,CD_antigen: CD124
Reference PX-P4860
Note For research use only
Molecular Constructor
Met1–His232 His

Dupilumab Biosimilar - Anti-IL4R, CD124 mAb binds to Interleukin-4 receptor subunit alpha(IL4R) in indirect ELISA Assay

Dupilumab Biosimilar - Anti-IL4R, CD124 mAb binds to Interleukin-4 receptor subunit alpha(IL4R) in indirect ELISA Assay

Immobilized Interleukin-4 receptor subunit alpha(IL4R) (cat. No.PX-P4860) at 0.5µg/mL (100µL/well) can bind to Dupilumab Biosimilar - Anti-IL4R, CD124 mAb (cat. No.PX-TA1308) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Interleukin-4 receptor subunit alpha(IL4R)

There are no reviews yet.

Be the first to review “Interleukin-4 receptor subunit alpha(IL4R)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products