Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Interleukin-31 receptor subunit alpha(IL31RA)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q8NI17
Molecular weight:
55.75 kDa

€142.00

100ug + 142 loyalty points
Val130–Asp622 N terminus His
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Interleukin-2 receptor subunit alpha(IL2RA) binds to Daclizumab Biosimilar - Anti-IL2RA mAb in indirect ELISA assay

Interleukin-31 receptor subunit alpha(IL31RA)

Product name Interleukin-31 receptor subunit alpha(IL31RA)
Uniprot ID Q8NI17
Uniprot link https://www.uniprot.org/uniprot/Q8NI17
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence VKPVLGIKRMIQIEWIKPELAPVSSDLKYTLRFRTVNSTSWMEVNFAKNRKDKNQTYNLTGLQPFTEYVIAL RCAVKESKFWSDWSQEKMGMTEEEAPCGLELWRVLKPAEADGRRPVRLLWKKARGAPVLEKTLGYNIWYYPE SNTNLTETMNTTNQQLELHLGGESFWVSMISYNSLGKSPVATLRIPAIQEKSFQCIEVMQACVAEDQLVVKW QSSALDVNTWMIEWFPDVDSEPTTLSWESVSQATNWTIQQDKLKPFWCYNISVYPMLHDKVGEPYSIQAYAK EGVPSEGPETKVENIGVKTVTITWKEIPKSERKGIICNYTIFYQAEGGKGFSKTVNSSILQYGLESLKRKTS YIVQVMASTSAGGTNGTSINFKTLSFSVFEIILITSLIGGGLLILIILTVAYGLKKPNKLTHLCWPTVPNPA ESSIATWHGDDFKDKLNLKESDDSVNTEDRILKPCSTPSDKLVIDKLVVNFGNVLQEIFTD
Molecular weight 55.75 kDa
Protein delivered with Tag? N terminus His tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val130-Asp622
Protein Accession Q8NI17
Spec:Entrez GeneID 133396
Spec:NCBI Gene Aliases CRL; GPL; CRL3; GLMR; GLM-R; PLCA2; hGLM-R; IL-31RA; PRO21384; zcytoR17
Spec:SwissProtID Q8WYJ0
NCBI Reference Q8NI17
Aliases /Synonyms IL-31 receptor subunit alpha，IL-31R subunit alpha，IL-31R-alpha，IL-31RA，Cytokine receptor-like 3，GLM-R，hGLM-R，Gp130-like monocyte receptor，Gp130-like receptor，ZcytoR17，CRL3, GPL
Reference PX-P4802
Note For research use only
Molecular Constructor
Val130–Asp622 N terminus His
Product name Interleukin-31 receptor subunit alpha(IL31RA)
Uniprot ID Q8NI17
Uniprot link https://www.uniprot.org/uniprot/Q8NI17
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence VKPVLGIKRMIQIEWIKPELAPVSSDLKYTLRFRTVNSTSWMEVNFAKNRKDKNQTYNLTGLQPFTEYVIAL RCAVKESKFWSDWSQEKMGMTEEEAPCGLELWRVLKPAEADGRRPVRLLWKKARGAPVLEKTLGYNIWYYPE SNTNLTETMNTTNQQLELHLGGESFWVSMISYNSLGKSPVATLRIPAIQEKSFQCIEVMQACVAEDQLVVKW QSSALDVNTWMIEWFPDVDSEPTTLSWESVSQATNWTIQQDKLKPFWCYNISVYPMLHDKVGEPYSIQAYAK EGVPSEGPETKVENIGVKTVTITWKEIPKSERKGIICNYTIFYQAEGGKGFSKTVNSSILQYGLESLKRKTS YIVQVMASTSAGGTNGTSINFKTLSFSVFEIILITSLIGGGLLILIILTVAYGLKKPNKLTHLCWPTVPNPA ESSIATWHGDDFKDKLNLKESDDSVNTEDRILKPCSTPSDKLVIDKLVVNFGNVLQEIFTD
Molecular weight 55.75 kDa
Protein delivered with Tag? N terminus His tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val130-Asp622
Protein Accession Q8NI17
Spec:Entrez GeneID 133396
Spec:NCBI Gene Aliases CRL; GPL; CRL3; GLMR; GLM-R; PLCA2; hGLM-R; IL-31RA; PRO21384; zcytoR17
Spec:SwissProtID Q8WYJ0
NCBI Reference Q8NI17
Aliases /Synonyms IL-31 receptor subunit alpha，IL-31R subunit alpha，IL-31R-alpha，IL-31RA，Cytokine receptor-like 3，GLM-R，hGLM-R，Gp130-like monocyte receptor，Gp130-like receptor，ZcytoR17，CRL3, GPL
Reference PX-P4802
Note For research use only
Molecular Constructor
Val130–Asp622 N terminus His

Interleukin-2 receptor subunit alpha(IL2RA) binds to Daclizumab Biosimilar - Anti-IL2RA mAb in indirect ELISA assay

Interleukin-2 receptor subunit alpha(IL2RA) binds to Daclizumab Biosimilar - Anti-IL2RA mAb in indirect ELISA assay

Immobilized Interleukin-2 receptor subunit alpha(IL2RA) (cat. No.PX-P4704) at 0.5µg/mL (100µL/well) can bind Daclizumab Biosimilar - Anti-IL2RA mAb (cat. No.PX-TA1038) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 175.8M.

There are no reviews yet.

Be the first to review “Interleukin-31 receptor subunit alpha(IL31RA)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products