Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Interferon alpha

Host species:
Escherichia coli (E.coli)
Uniprot ID:
A0PA06
Molecular weight:
20.85KDa

Original price was: €248.00.Current price is: €210.00.

50ug 15% OFF + 210 loyalty points
Cys24–Glu186
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Interferon alpha

Product name Interferon alpha
Uniprot ID A0PA06
Uniprot link https://www.uniprot.org/uniprot/A0PA06
Expression system Prokaryotic expression
Raw Antigen Sequence CDLPLTHSLVDRRALILLGQMRRISPFSCLKDREDFGFPQGVLHGNQFQEAQAIAVAHEVTRQTFLLFCTEASSAAWDETLRSRFCTGLYQQLIHLEACQTREVGAEETPLLDEDSTLAVRSYFQRLFLYLQEKKHSPCAWEIIRAEIMRSYSLSTHLKETKE
Molecular weight 20.85KDa
Purity estimated 90%
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys24-Glu186
Aliases /Synonyms Interferon alpha
Reference PX-P4357
Note For research use only
Molecular Constructor
Cys24–Glu186
Product name Interferon alpha
Uniprot ID A0PA06
Uniprot link https://www.uniprot.org/uniprot/A0PA06
Expression system Prokaryotic expression
Raw Antigen Sequence CDLPLTHSLVDRRALILLGQMRRISPFSCLKDREDFGFPQGVLHGNQFQEAQAIAVAHEVTRQTFLLFCTEASSAAWDETLRSRFCTGLYQQLIHLEACQTREVGAEETPLLDEDSTLAVRSYFQRLFLYLQEKKHSPCAWEIIRAEIMRSYSLSTHLKETKE
Molecular weight 20.85KDa
Purity estimated 90%
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys24-Glu186
Aliases /Synonyms Interferon alpha
Reference PX-P4357
Note For research use only
Molecular Constructor
Cys24–Glu186
Product name PX-P4357-1MG
Uniprot ID A0PA06
Uniprot link https://www.uniprot.org/uniprot/A0PA06
Expression system Prokaryotic expression
Raw Antigen Sequence CDLPLTHSLVDRRALILLGQMRRISPFSCLKDREDFGFPQGVLHGNQFQEAQAIAVAHEVTRQTFLLFCTEASSAAWDETLRSRFCTGLYQQLIHLEACQTREVGAEETPLLDEDSTLAVRSYFQRLFLYLQEKKHSPCAWEIIRAEIMRSYSLSTHLKETKE
Molecular weight 20.85KDa
Purity estimated 90%
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys24-Glu186
Aliases /Synonyms Interferon alpha
Reference PX-P4357
Note For research use only
Molecular Constructor
Cys24–Glu186

Interferon alpha

There are no reviews yet.

Be the first to review “Interferon alpha”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products