Cart (0 Items)
Your cart is currently empty.
View ProductsIntegrator complex subunit 3(Ints3)
| Size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Applications | Elisa, WB |
| Product name | Integrator complex subunit 3(Ints3) |
|---|---|
| Uniprot ID | Q7TPD0 |
| Uniprot link | https://www.uniprot.org/uniprot/Q7TPD0 |
| Origin species | House Mouse |
| Expression system | Prokaryotic expression |
| Sequence | MGTEESLEESVGKPLYLIFRNLCQMQEDNSSFSLLLDLLSELYQKQPKIGYHLLYYLRASKAAAGKMNLYESFAQATQLGDLHTCLMMDMKACQEDDVRLLCHLTPSIYTEFPDETLRSGELLNMIVAVIDSAQLQELVCHVMMGNLVMFRKDSVLNILIQSLDWETFEQYCAWQLFLAHNIPLETIIPILQHLKYKEHPEALSCLLLQLRREKPSEEMVKMVLSRPCHPDDQFTTSILRHWCMKHDELLAEHIKSLEHHHHHH |
| Molecular weight | 28.83kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90%by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Applications | ELISA,WB |
| Fragment Type | Thr639-Lys891 |
| Protein Accession | Q7TPD0 |
| Spec:Entrez GeneID | 229543 |
| Spec:NCBI Gene Aliases | C77668 |
| Spec:SwissProtID | Q99LK7 |
| NCBI Reference | Q7TPD0 |
| Aliases /Synonyms | Int3, SOSS complex subunit A,Sensor of single-strand DNA complex subunit A,SOSS-A,Sensor of ssDNA subunit A |
| Reference | PX-P4683 |
| Note | For research use only |
Related products
Tag Antibody
Anti His tag mouse monoclonal antibody
PTX17851 180€Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.