Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

IL8 / CXCL8, C-His, recombinant protein

  • PX-P5796
  • Validated ELISA
Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P10145
Molecular weight:
9.89 kDa

€379.00

100ug + 379 loyalty points
Ala23–Ser99 His
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

IL8 / CXCL8, C-His, recombinant protein

Product name IL8 / CXCL8, C-His, recombinant protein
Uniprot ID P10145
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Molecular weight 9.89 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala23-Ser99
Protein Accession P10145
Reference PX-P5796
Note For research use only.
Molecular Constructor
Ala23–Ser99 His

9-77 Biosimilar - Anti-IL-8 mAb binds to IL8/CXCL8 in indirect ELISA Assay

9-77 Biosimilar - Anti-IL-8 mAb binds to IL8/CXCL8 in indirect ELISA Assay

Immobilized IL8 / CXCL8, C-His, recombinant protein (cat. No.PX-P5796) at 0.5µg/mL (100µL/well) can bind to 9-77 Biosimilar - Anti-IL-8 mAb (cat. No.PX-TA1618) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD451

IL8 / CXCL8, C-His, recombinant protein

There are no reviews yet.

Be the first to review “IL8 / CXCL8, C-His, recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products