Brand: ProteoGenix

IGFBP1 protein – Human IGFBP1 full length Recombinant Protein

PX-P2077-10
Quality Chart

Host species:: Escherichia coli (E.coli)
Origin species:: Homo sapiens (Human)
Uniprot ID:: P08833
Molecular weight:: 28.74kDa

€210.00

+ 210 loyalty points

Full-length Yes

size size

50ug €210.00
100ug €329.00

Clear

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

SDS-PAGE for ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein

IGFBP1 protein - Human IGFBP1 full length Recombinant Protein

Product name	IGFBP1 protein - Human IGFBP1 full length Recombinant Protein
Uniprot ID	P08833
Uniprot link	http://www.uniprot.org/uniprot/P08833
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	MKYLLPTAAAGLLLLAAQPAMA^MDAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYF
Molecular weight	28.74kDa
Protein delivered with Tag?	Yes
Purity estimated	95%
Buffer	PBS, pH 7.5 with 0.2mM β-Met and glycerol 2.5%
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Full-length
Protein Accession	ACO37638.1
Spec:Entrez GeneID	3484
Spec:NCBI Gene Aliases	hIGFBP-1, AFBP, IBP1, PP12, IGF-BP25
Spec:SwissProtID	P08833
NCBI Reference	ACO37638.1
Aliases /Synonyms	IGFBP1 full length, insulin-like Growth Factor proteins binding protein 1, Insulin-like Growth Factor proteins-binding protein 1
Reference	PX-P2077
Note	For research use only
Molecular Constructor	Full-length Yes

Product name	IGFBP1 protein - Human IGFBP1 full length Recombinant Protein
Uniprot ID	P08833
Uniprot link	http://www.uniprot.org/uniprot/P08833
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	MKYLLPTAAAGLLLLAAQPAMA^MDAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYF
Molecular weight	28.74kDa
Protein delivered with Tag?	Yes
Purity estimated	95%
Buffer	PBS, pH 7.5 with 0.2mM β-Met and glycerol 2.5%
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Full-length
Protein Accession	ACO37638.1
Spec:Entrez GeneID	3484
Spec:NCBI Gene Aliases	hIGFBP-1, AFBP, IBP1, PP12, IGF-BP25
Spec:SwissProtID	P08833
NCBI Reference	ACO37638.1
Aliases /Synonyms	IGFBP1 full length, insulin-like Growth Factor proteins binding protein 1, Insulin-like Growth Factor proteins-binding protein 1
Reference	PX-P2077
Note	For research use only
Molecular Constructor	Full-length Yes

SDS-PAGE for ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein

ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein, on SDS-PAGE under reducing

There are no reviews yet.

Be the first to review “IGFBP1 protein – Human IGFBP1 full length Recombinant Protein”

IGFBP1 protein – Human IGFBP1 full length Recombinant Protein

IGFBP1 protein - Human IGFBP1 full length Recombinant Protein

SDS-PAGE for ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein

Recently viewed products

Can’t find what you need?

Cart (0 Items)

IGFBP1 protein – Human IGFBP1 full length Recombinant Protein

Specifications IGFBP1 protein - Human IGFBP1 full length Recombinant Protein

Documents

QC & Validation

SDS-PAGE for ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein

Reviews

Recently viewed products

Can’t find what you need?

Cart (0 Items)

IGFBP1 protein - Human IGFBP1 full length Recombinant Protein