Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
  • Wide range of unique reagents
  • Free Shipping
    Free shipping in EU on Orders > €500
  • Fast worldwide delivery
    Fast worldwide delivery

IGFBP1 protein – Human IGFBP1 full length Recombinant Protein

Reference:
size

100ug, 50ug

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Escherichia coli (E. coli)

Applications

Elisa, WB

Product nameIGFBP1 protein - Human IGFBP1 full length Recombinant Protein
Uniprot IDP08833
Uniprot linkhttp://www.uniprot.org/uniprot/P08833
Origin speciesHomo sapiens (Human)
Expression systemProkaryotic expression
SequenceMKYLLPTAAAGLLLLAAQPAMA^MDAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYF
Molecular weight28.74kDa
Protein delivered with Tag?Yes
Purity estimated95%
BufferPBS, pH 7.5 with 0.2mM β-Met and glycerol 2.5%
FormLyophilized
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeFull-length
Protein AccessionACO37638.1
Spec:Entrez GeneID3484
Spec:NCBI Gene AliaseshIGFBP-1, AFBP, IBP1, PP12, IGF-BP25
Spec:SwissProtIDP08833
NCBI ReferenceACO37638.1
Aliases /SynonymsIGFBP1 full length, insulin-like Growth Factor proteins binding protein 1, Insulin-like Growth Factor proteins-binding protein 1
ReferencePX-P2077
NoteFor research use only

SDS-PAGE for ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein

ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein, on SDS-PAGE under reducing

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “IGFBP1 protein – Human IGFBP1 full length Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.

    Cart (0 Items)

    Your cart is currently empty.

    View Products