Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Humanized DQB1-FL8 Biosimilar – Anti-HLA-DQB mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1

Original price was: €344.00.Current price is: €259.00.

50ug 25% OFF + 259 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Humanized DQB1-FL8 Biosimilar - Anti-HLA-DQB mAb - Research Grade

Product name Humanized DQB1-FL8 Biosimilar - Anti-HLA-DQB mAb - Research Grade
Uniprot ID P01920
Source DQB1-FL8, LG11
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MSWKKALRIPGGLRAATVTLMLAMLSTPVAEGRDSPEDFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQSESAQSKMLSGIGGFVLGLIFLGLGLIIHHRSQKGLLH
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-HLA-DQB,MHC class II antigen DQB1,HLA-DQB1,HLA class II histocompatibility antigen,DQ beta 1 chain,LG11,DQB1-FL8, LG11
Reference PX-TA1894
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Clonality Monoclonal Antibody
Product name Humanized DQB1-FL8 Biosimilar - Anti-HLA-DQB mAb - Research Grade
Uniprot ID P01920
Source DQB1-FL8, LG11
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MSWKKALRIPGGLRAATVTLMLAMLSTPVAEGRDSPEDFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQSESAQSKMLSGIGGFVLGLIFLGLGLIIHHRSQKGLLH
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-HLA-DQB,MHC class II antigen DQB1,HLA-DQB1,HLA class II histocompatibility antigen,DQ beta 1 chain,LG11,DQB1-FL8, LG11
Reference PX-TA1894
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Clonality Monoclonal Antibody
Product name PX-TA1894-50
Uniprot ID P01920
Source DQB1-FL8, LG11
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MSWKKALRIPGGLRAATVTLMLAMLSTPVAEGRDSPEDFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQSESAQSKMLSGIGGFVLGLIFLGLGLIIHHRSQKGLLH
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-HLA-DQB,MHC class II antigen DQB1,HLA-DQB1,HLA class II histocompatibility antigen,DQ beta 1 chain,LG11,DQB1-FL8, LG11
Reference PX-TA1894
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Clonality Monoclonal Antibody

Introduction:

Humanized DQB1-FL8 Biosimilar is a novel monoclonal antibody (mAb) that specifically targets the human leukocyte antigen-DQB1 (HLA-DQB1). This biosimilar is a recombinant version of the anti-HLA-DQB mAb, which has shown promising results in pre-clinical studies. In this article, we will discuss the structure, activity, and potential applications of Humanized DQB1-FL8 Biosimilar in the field of immunotherapy.

Structure:

Humanized DQB1-FL8 Biosimilar is a humanized IgG1 monoclonal antibody, which means that it is derived from a mouse antibody but has been modified to have a human-like structure. This modification is important for reducing the risk of immunogenicity and increasing the efficacy of the antibody in humans. The antibody has a molecular weight of approximately 150 kDa and consists of two heavy chains and two light chains, connected by disulfide bonds. It also contains a variable region, which is responsible for binding to the HLA-DQB1 antigen.

Activity:

The main function of Humanized DQB1-FL8 Biosimilar is to specifically bind to the HLA-DQB1 antigen, which is a major histocompatibility complex (MHC) class II molecule. HLA-DQB1 is expressed on the surface of antigen-presenting cells, such as dendritic cells, macrophages, and B cells. This antigen is responsible for presenting foreign antigens to T cells, which then trigger an immune response. By binding to HLA-DQB1, Humanized DQB1-FL8 Biosimilar inhibits the interaction between the antigen-presenting cells and T cells, thereby suppressing the immune response.

Application:

Humanized DQB1-FL8 Biosimilar has potential therapeutic applications in various autoimmune diseases, such as rheumatoid arthritis, multiple sclerosis, and type 1 diabetes. In these conditions, the immune system mistakenly attacks the body’s own tissues, leading to chronic inflammation and tissue damage. By targeting HLA-DQB1, Humanized DQB1-FL8 Biosimilar can suppress the immune response and reduce inflammation, thus providing a potential treatment option for these diseases.

In addition, Humanized DQB1-FL8 Biosimilar can also be used in transplantation medicine. In organ transplantation, the immune system recognizes the transplanted organ as foreign and mounts an immune response, leading to rejection of the organ. By targeting HLA-DQB1, Humanized DQB1-FL8 Biosimilar can prevent the immune system from recognizing the transplanted organ as foreign, thus reducing the risk of rejection and improving the success rate of transplantation.

Research Grade:

Humanized DQB1-FL8 Biosimilar is currently in the pre-clinical stage of development and is being evaluated for its safety and efficacy in animal models. The biosimilar is produced using recombinant DNA technology, which allows for large-scale production and ensures consistent quality. The research grade of Humanized DQB1-FL8 Biosimilar is suitable for in vitro and in vivo studies to further understand its mechanism of action and potential therapeutic applications.

Conclusion:

Humanized DQB1-FL8 Biosimilar is a promising monoclonal antibody that targets the HLA-DQB1 antigen. Its humanized structure and specific binding to HLA-DQB1 make it a potential candidate for the treatment of autoimmune diseases and in transplantation medicine. The biosimilar is currently in the pre-clinical stage, and further studies are needed to determine its safety and efficacy in humans. With its potential to modulate the immune response, Humanized DQB1-FL8 Biosimilar has the potential to revolutionize the field of immunotherapy and improve the lives of patients with autoimmune diseases and organ transplantation.

SDS-PAGE for Humanized DQB1-FL8 Biosimilar - Anti-HLA-DQB mAb - Research Grade

SDS-PAGE for Humanized DQB1-FL8 Biosimilar - Anti-HLA-DQB mAb - Research Grade

Humanized DQB1-FL8 Biosimilar - Anti-HLA-DQB mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Humanized DQB1-FL8 Biosimilar - Anti-HLA-DQB mAb - Research Grade

There are no reviews yet.

Be the first to review “Humanized DQB1-FL8 Biosimilar – Anti-HLA-DQB mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products