Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human XIAP Recombinant Protein, N-His

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P98170

Original price was: €296.00.Current price is: €228.00.

50ug 23% OFF + 228 loyalty points
His Asn252–Thr356
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Human XIAP Recombinant Protein, N-His

Human XIAP Recombinant Protein, N-His

Product name ARO-P17773-100
Uniprot ID P98170
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence NSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asn252-Thr356
Aliases /Synonyms E3 ubiquitin-protein ligase XIAP, 2.3.2.27, Baculoviral IAP repeat-containing protein 4, IAP-like protein, ILP, hILP, Inhibitor of apoptosis protein 3, IAP-3, hIAP-3, hIAP3, RING-type E3 ubiquitin transferase XIAP, X-linked inhibitor of apoptosis protein, X-linked IAP, XIAP, API3, BIRC4, IAP3
Reference ARO-P17773
Note For research use only.
Molecular Constructor
His Asn252–Thr356
Product name ARO-P17773-1MG
Uniprot ID P98170
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence NSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asn252-Thr356
Aliases /Synonyms E3 ubiquitin-protein ligase XIAP, 2.3.2.27, Baculoviral IAP repeat-containing protein 4, IAP-like protein, ILP, hILP, Inhibitor of apoptosis protein 3, IAP-3, hIAP-3, hIAP3, RING-type E3 ubiquitin transferase XIAP, X-linked inhibitor of apoptosis protein, X-linked IAP, XIAP, API3, BIRC4, IAP3
Reference ARO-P17773
Note For research use only.
Molecular Constructor
His Asn252–Thr356
Product name ARO-P17773-50
Uniprot ID P98170
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence NSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asn252-Thr356
Aliases /Synonyms E3 ubiquitin-protein ligase XIAP, 2.3.2.27, Baculoviral IAP repeat-containing protein 4, IAP-like protein, ILP, hILP, Inhibitor of apoptosis protein 3, IAP-3, hIAP-3, hIAP3, RING-type E3 ubiquitin transferase XIAP, X-linked inhibitor of apoptosis protein, X-linked IAP, XIAP, API3, BIRC4, IAP3
Reference ARO-P17773
Note For research use only.
Molecular Constructor
His Asn252–Thr356

There are no reviews yet.

Be the first to review “Human XIAP Recombinant Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products