Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human VTCN1/B7-H4 Monoclonal Antibody

  • ARO-A16160-50
  • Validated FC

Original price was: €300.00.Current price is: €231.00.

50ug 23% OFF + 231 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Flow Cytometry results for Human VTCN1/B7-H4 Monoclonal Antibody
Human VTCN1/B7-H4 Monoclonal Antibody

Human VTCN1/B7-H4 Monoclonal Antibody

Product name ARO-A16160-100
Uniprot ID Q7Z7D3
Uniprot link Q7Z7D3
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms V-set domain-containing T-cell activation inhibitor 1, B7h.5, B7 homolog 4, B7-H4, T-cell costimulatory molecule B7x, B7H4, VTCN1, Protein B7S1, Immune costimulatory protein B7-H4
Reference ARO-A16160
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen VTCN1/B7-H4
Clone Name SAA0156
Protein Name VTCN1/B7-H4
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16160-1MG
Uniprot ID Q7Z7D3
Uniprot link Q7Z7D3
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms V-set domain-containing T-cell activation inhibitor 1, B7h.5, B7 homolog 4, B7-H4, T-cell costimulatory molecule B7x, B7H4, VTCN1, Protein B7S1, Immune costimulatory protein B7-H4
Reference ARO-A16160
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen VTCN1/B7-H4
Clone Name SAA0156
Protein Name VTCN1/B7-H4
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16160-50
Uniprot ID Q7Z7D3
Uniprot link Q7Z7D3
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms V-set domain-containing T-cell activation inhibitor 1, B7h.5, B7 homolog 4, B7-H4, T-cell costimulatory molecule B7x, B7H4, VTCN1, Protein B7S1, Immune costimulatory protein B7-H4
Reference ARO-A16160
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen VTCN1/B7-H4
Clone Name SAA0156
Protein Name VTCN1/B7-H4
Target species Anti-Human Monoclonal Antibody

Flow Cytometry results for Human VTCN1/B7-H4 Monoclonal Antibody

Flow Cytometry results for Human VTCN1/B7-H4 Monoclonal Antibody

Target Cells were stained with an irrelevant antibody or Human VTCN1/B7-H4 Monoclonal Antibody at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Human VTCN1/B7-H4 Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human VTCN1/B7-H4 Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products