Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Felmetatug Biosimilar – Anti-VTCN1 – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG

Original price was: €196.00.Current price is: €140.00.

50ug 29% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Felmetatug Biosimilar - Anti-VTCN1 - Research Grade

Product name PX-TA2306-100
Uniprot ID Q7Z7D3
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-VTCN1, Anti-B7-H4, Felmetatug vedotin, PF 08046048, PF-08046048, CAS: 159858-33-0
Isotype IgG
Clonality Monoclonal Antibody
Protein Name VTCN1
Product name PX-TA2306-1MG
Uniprot ID Q7Z7D3
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-VTCN1, Anti-B7-H4, Felmetatug vedotin, PF 08046048, PF-08046048, CAS: 159858-33-0
Isotype IgG
Clonality Monoclonal Antibody
Protein Name VTCN1
Product name PX-TA2306-50
Uniprot ID Q7Z7D3
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-VTCN1, Anti-B7-H4, Felmetatug vedotin, PF 08046048, PF-08046048, CAS: 159858-33-0
Isotype IgG
Clonality Monoclonal Antibody
Protein Name VTCN1

Introduction

Felmetatug Biosimilar – Anti-VTCN1 – Research Grade is a novel antibody that has been developed for the treatment of various diseases. This biosimilar is a highly specific and potent inhibitor of VTCN1, a protein that is involved in immune regulation and has been identified as a therapeutic target for several diseases.

Structure of Felmetatug Biosimilar

Felmetatug Biosimilar is a monoclonal antibody that is produced using recombinant DNA technology. It is a humanized antibody, meaning that it is derived from a non-human source but has been genetically engineered to have a structure that is similar to human antibodies. This allows for better compatibility and reduces the risk of immune reactions in patients.

The antibody has a Y-shaped structure, with two identical heavy chains and two identical light chains. These chains are connected by disulfide bonds and are responsible for the binding of the antibody to its target, VTCN1.

Activity of Felmetatug Biosimilar

Felmetatug Biosimilar has a high affinity for VTCN1, meaning that it binds to the protein with great specificity and strength. This binding prevents VTCN1 from interacting with its receptors on immune cells, thereby inhibiting its activity. VTCN1 is known to play a role in suppressing immune responses, and its overexpression has been linked to various diseases such as cancer, autoimmune disorders, and infectious diseases. By inhibiting VTCN1, Felmetatug Biosimilar helps to restore normal immune function and combat these diseases.

In addition to its inhibitory activity, Felmetatug Biosimilar also has an immunomodulatory effect. It can activate various immune cells, such as T cells and natural killer cells, to enhance their anti-tumor and anti-viral activities. This makes it a promising therapy for diseases that involve dysregulated immune responses.

Application of Felmetatug Biosimilar

Felmetatug Biosimilar is currently being studied as a potential treatment for a variety of diseases, including:

Cancer VTCN1 has been found to be overexpressed in many types of cancer, and its inhibition has shown promising results in preclinical studies. Felmetatug Biosimilar is being investigated as a monotherapy and in combination with other cancer treatments to improve outcomes for cancer patients.

Autoimmune disorders

In autoimmune disorders, the immune system mistakenly attacks healthy cells and tissues. By inhibiting VTCN1, Felmetatug Biosimilar can help regulate the immune response and reduce inflammation in these diseases. It is being studied for the treatment of diseases such as rheumatoid arthritis, multiple sclerosis, and lupus.

Infectious diseases

VTCN1 has been shown to play a role in the immune response to viral and bacterial infections. By inhibiting VTCN1, Felmetatug Biosimilar can enhance the immune response and help fight these infections. It is being investigated as a potential treatment for diseases such as HIV, hepatitis B, and tuberculosis.

Transplant rejection

VTCN1 is involved in the immune response to transplanted organs, and its inhibition has been shown to improve transplant outcomes. Felmetatug Biosimilar is being studied as a potential therapy to prevent transplant rejection and improve the success of organ transplants.

Conclusion

In summary, Felmetatug Biosimilar – Anti-VTCN1 – Research Grade is a novel antibody that has been developed as a potential treatment for various diseases. Its high specificity and potency make it a promising therapy for conditions involving dysregulated immune responses. Further research and clinical trials are needed to fully understand its potential and determine its effectiveness in treating these diseases.

SDS-PAGE for Felmetatug Biosimilar - Anti-VTCN1 - Research Grade

SDS-PAGE for Felmetatug Biosimilar - Anti-VTCN1 - Research Grade

Felmetatug Biosimilar - Anti-VTCN1 - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Felmetatug Biosimilar – Anti-VTCN1 – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products