Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human VEGFR2 Protein, C-Fc

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P35968

Original price was: €285.00.Current price is: €228.00.

50ug 20% OFF + 228 loyalty points

Recombinant Human VEGF Protein for VEGF Signaling Studies

Recombinant VEGF protein designed for VEGF pathway and endothelial cell research. Suitable for a wide range of laboratory applications.

Met1–Lys327 Fc
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human VEGFR2 Protein, C-Fc

Product name ARO-P18615-100
Uniprot ID P35968
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MQSKVLLAVALWLCVETRAASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEK
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Lys327
Aliases /Synonyms Vascular endothelial growth factor receptor 2, VEGFR-2, EC:2.7.10.1, Fetal liver kinase 1, FLK-1, Kinase insert domain receptor, KDR, Protein-tyrosine kinase receptor flk-1, CD309, KDR, FLK1, VEGFR2
Reference ARO-P18615
Note For research use only.
Molecular Constructor
Met1–Lys327 Fc
Product name ARO-P18615-1MG
Uniprot ID P35968
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MQSKVLLAVALWLCVETRAASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEK
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Lys327
Aliases /Synonyms Vascular endothelial growth factor receptor 2, VEGFR-2, EC:2.7.10.1, Fetal liver kinase 1, FLK-1, Kinase insert domain receptor, KDR, Protein-tyrosine kinase receptor flk-1, CD309, KDR, FLK1, VEGFR2
Reference ARO-P18615
Note For research use only.
Molecular Constructor
Met1–Lys327 Fc
Product name ARO-P18615-50
Uniprot ID P35968
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MQSKVLLAVALWLCVETRAASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEK
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Lys327
Aliases /Synonyms Vascular endothelial growth factor receptor 2, VEGFR-2, EC:2.7.10.1, Fetal liver kinase 1, FLK-1, Kinase insert domain receptor, KDR, Protein-tyrosine kinase receptor flk-1, CD309, KDR, FLK1, VEGFR2
Reference ARO-P18615
Note For research use only.
Molecular Constructor
Met1–Lys327 Fc

What is recombinant VEGF protein?

Recombinant human VEGF protein is a signaling molecule involved in vascular biology and cellular communication processes. It is commonly used in research to study VEGF-mediated pathways and endothelial cell responses.

Biological role of VEGF

VEGF interacts with specific receptors on endothelial cells and contributes to the regulation of cell growth and vascular-related mechanisms. Recombinant VEGF protein is widely used in laboratory studies to investigate these signaling pathways.

Applications

  • VEGF signaling pathway studies
  • Endothelial cell research
  • Cell culture experiments
  • Protein interaction studies
  • General vascular biology research

Key features

  • Recombinant human VEGF protein
  • Suitable for research applications
  • Consistent quality and reproducibility
  • Designed for laboratory use

Need a specific VEGF protein?

If your research requires a particular format, expression system, or modification, custom recombinant protein development solutions can support your experimental needs.

There are no reviews yet.

Be the first to review “Recombinant Human VEGFR2 Protein, C-Fc”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products