Brand: ProteoGenix

Human ULBP3 Recombinant Protein, C-His

ARO-P19576-50
Quality Chart

Host species:: Mammalian cells
Origin species:: Human
Uniprot ID:: Q9BZM4
Molecular weight:: 24.59 kDa

Original price was: €294.00.Current price is: €228.00.

50ug 22% OFF + 228 loyalty points

Ser33–Gly217 His

Size Size

50ug Original price was: €294.00.Current price is: €228.00.
100ug Original price was: €377.00.Current price is: €325.00.
1MG Original price was: €1,066.00.Current price is: €943.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Human ULBP3 Recombinant Protein, C-His

Product name	ARO-P19576-100
Uniprot ID	Q9BZM4
Origin species	Human
Expression system	Eukaryotic expression
Raw Antigen Sequence	SLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSDKVLSMGHLEEQLYATDAWGKQLEMLREVGQRLRLELADTELEDFTPSGPLTLQVRMSCECEADGYIRGSWQFSFDGRKFLLFDSNNRKWTVVHAGARRMKEKWEKDSGLTTFFKMVSMRDCKSWLRDFLMHRKKRLEPTAPPTMAPG
Molecular weight	24.59 kDa
Protein delivered with Tag?	C-Terminal His Tag
Buffer	Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Ser33-Gly217
Aliases /Synonyms	ALCAN-gamma, N2DL-3, N2DL3, NKG2D ligand 3, NKG2DL3, RAET1N, Retinoic acid early transcript 1N, UL16-binding protein 3, ULBP3
Reference	ARO-P19576
Note	For research use only.
Molecular Constructor	Ser33–Gly217 His

Product name	ARO-P19576-1MG
Uniprot ID	Q9BZM4
Origin species	Human
Expression system	Eukaryotic expression
Raw Antigen Sequence	SLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSDKVLSMGHLEEQLYATDAWGKQLEMLREVGQRLRLELADTELEDFTPSGPLTLQVRMSCECEADGYIRGSWQFSFDGRKFLLFDSNNRKWTVVHAGARRMKEKWEKDSGLTTFFKMVSMRDCKSWLRDFLMHRKKRLEPTAPPTMAPG
Molecular weight	24.59 kDa
Protein delivered with Tag?	C-Terminal His Tag
Buffer	Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Ser33-Gly217
Aliases /Synonyms	ALCAN-gamma, N2DL-3, N2DL3, NKG2D ligand 3, NKG2DL3, RAET1N, Retinoic acid early transcript 1N, UL16-binding protein 3, ULBP3
Reference	ARO-P19576
Note	For research use only.
Molecular Constructor	Ser33–Gly217 His

Product name	ARO-P19576-50
Uniprot ID	Q9BZM4
Origin species	Human
Expression system	Eukaryotic expression
Raw Antigen Sequence	SLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSDKVLSMGHLEEQLYATDAWGKQLEMLREVGQRLRLELADTELEDFTPSGPLTLQVRMSCECEADGYIRGSWQFSFDGRKFLLFDSNNRKWTVVHAGARRMKEKWEKDSGLTTFFKMVSMRDCKSWLRDFLMHRKKRLEPTAPPTMAPG
Molecular weight	24.59 kDa
Protein delivered with Tag?	C-Terminal His Tag
Buffer	Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Ser33-Gly217
Aliases /Synonyms	ALCAN-gamma, N2DL-3, N2DL3, NKG2D ligand 3, NKG2DL3, RAET1N, Retinoic acid early transcript 1N, UL16-binding protein 3, ULBP3
Reference	ARO-P19576
Note	For research use only.
Molecular Constructor	Ser33–Gly217 His