Brand: ProteoGenix

Human TNFSF12 recombinant protein

PX-P6489-50
Quality Chart

Host species:: Mammalian cells
Origin species:: Human
Uniprot ID:: O43508
Molecular weight:: 25.95 kDa

Original price was: €218.00.Current price is: €193.00.

50ug 11% OFF + 193 loyalty points

Ser43–His249 His

Size Size

50ug Original price was: €218.00.Current price is: €193.00.
100ug Original price was: €338.00.Current price is: €275.00.
1MG Original price was: €950.00.Current price is: €798.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Human TNFSF12 recombinant protein

Product name	PX-P6489-100
Uniprot ID	O43508
Origin species	Human
Expression system	Eukaryotic expression
Raw Antigen Sequence	SLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
Molecular weight	25.95 kDa
Protein delivered with Tag?	C-Terminal His Tag
Buffer	PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Ser43-His249
Aliases /Synonyms	APO3 ligand, TNF-related weak inducer of apoptosis, TWEAK, Tumor necrosis factor ligand superfamily member 12, membrane form, Tumor necrosis factor ligand superfamily member 12, secreted form, TNFSF12, APO3L, DR3LG, UNQ181/PRO207Tumor necrosis factor ligand superfamily member 12,
Reference	PX-P6489
Molecular Constructor	Ser43–His249 His

Product name	PX-P6489-1MG
Uniprot ID	O43508
Origin species	Human
Expression system	Eukaryotic expression
Raw Antigen Sequence	SLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
Molecular weight	25.95 kDa
Protein delivered with Tag?	C-Terminal His Tag
Buffer	PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Ser43-His249
Aliases /Synonyms	APO3 ligand, TNF-related weak inducer of apoptosis, TWEAK, Tumor necrosis factor ligand superfamily member 12, membrane form, Tumor necrosis factor ligand superfamily member 12, secreted form, TNFSF12, APO3L, DR3LG, UNQ181/PRO207Tumor necrosis factor ligand superfamily member 12,
Reference	PX-P6489
Molecular Constructor	Ser43–His249 His

Product name	PX-P6489-50
Uniprot ID	O43508
Origin species	Human
Expression system	Eukaryotic expression
Raw Antigen Sequence	SLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
Molecular weight	25.95 kDa
Protein delivered with Tag?	C-Terminal His Tag
Buffer	PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Ser43-His249
Aliases /Synonyms	APO3 ligand, TNF-related weak inducer of apoptosis, TWEAK, Tumor necrosis factor ligand superfamily member 12, membrane form, Tumor necrosis factor ligand superfamily member 12, secreted form, TNFSF12, APO3L, DR3LG, UNQ181/PRO207Tumor necrosis factor ligand superfamily member 12,
Reference	PX-P6489
Molecular Constructor	Ser43–His249 His