Brand: ProteoGenix

Human SSNA1 Recombinant Protein, N-GST & C-His

ARO-P20701-50
Quality Chart

Host species:: Escherichia coli (E.coli)
Origin species:: Human
Uniprot ID:: O43805
Molecular weight:: 38.14 kDa

Original price was: €290.00.Current price is: €228.00.

50ug 21% OFF + 228 loyalty points

GST Leu15–Glu99 His

Size Size

50ug Original price was: €290.00.Current price is: €228.00.
100ug Original price was: €413.00.Current price is: €325.00.
1MG Original price was: €1,132.00.Current price is: €943.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Human SSNA1 Recombinant Protein, N-GST & C-His

Product name	ARO-P20701-100
Uniprot ID	O43805
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	LVKCIEELCQKREELCRQIQEEEDEKQRLQNEVRQLTEKLARVNENLARKIASRNEFDRTIAETEAAYLKILESSQTLLSVLKRE
Molecular weight	38.14 kDa
Protein delivered with Tag?	N-Terminal GST and C-Terminal His Tag
Buffer	Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Leu15-Glu99
Aliases /Synonyms	Microtubule nucleation factor SSNA1, NA14, Nuclear autoantigen of 14 kDa, SSNA1, Sjoegren syndrome nuclear autoantigen 1
Reference	ARO-P20701
Note	For research use only.
Molecular Constructor	GST Leu15–Glu99 His

Product name	ARO-P20701-1MG
Uniprot ID	O43805
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	LVKCIEELCQKREELCRQIQEEEDEKQRLQNEVRQLTEKLARVNENLARKIASRNEFDRTIAETEAAYLKILESSQTLLSVLKRE
Molecular weight	38.14 kDa
Protein delivered with Tag?	N-Terminal GST and C-Terminal His Tag
Buffer	Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Leu15-Glu99
Aliases /Synonyms	Microtubule nucleation factor SSNA1, NA14, Nuclear autoantigen of 14 kDa, SSNA1, Sjoegren syndrome nuclear autoantigen 1
Reference	ARO-P20701
Note	For research use only.
Molecular Constructor	GST Leu15–Glu99 His

Product name	ARO-P20701-50
Uniprot ID	O43805
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	LVKCIEELCQKREELCRQIQEEEDEKQRLQNEVRQLTEKLARVNENLARKIASRNEFDRTIAETEAAYLKILESSQTLLSVLKRE
Molecular weight	38.14 kDa
Protein delivered with Tag?	N-Terminal GST and C-Terminal His Tag
Buffer	Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Leu15-Glu99
Aliases /Synonyms	Microtubule nucleation factor SSNA1, NA14, Nuclear autoantigen of 14 kDa, SSNA1, Sjoegren syndrome nuclear autoantigen 1
Reference	ARO-P20701
Note	For research use only.
Molecular Constructor	GST Leu15–Glu99 His