Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Mammalian cells |
Applications | Elisa, WB |
Product name | Human Myoglobin recombinant protein |
---|---|
Uniprot ID | P02144 |
Uniprot link | http://www.uniprot.org/uniprot/P02144 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQGSHHHHHH |
Molecular weight | 18.06kDa |
Purity estimated | 70% |
Buffer | 50 mM Tris-HCl pH 7.5, 150 mM NaCl |
Form | Lyophilized |
Delivery condition | Dry Ice |
Delivery lead time in business days | 10-25 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Mammalian cells |
Applications | ELISA,WB |
Fragment Type | Full-length |
Aliases /Synonyms | myoglobin, PVALB, MB, MGC13548 |
Reference | PX-P4024 |
Note | For research use only |
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.