Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Human Leukocyte surface antigen CD47 recombinant protein |
|---|---|
| Uniprot ID | Q08722 |
| Uniprot link | http://www.uniprot.org/uniprot/Q08722 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNEGSHHHHHH |
| Molecular weight | 16.64kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 80% |
| Buffer | 50mM Tris-HCl pH 7.0, 150mM NaCl |
| Form | Lyophilized |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 5-7 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Partial |
| Aliases /Synonyms | CD47, MER6, OA3, Antigen Identified By Monoclonal Antibody 1D8, Antigenic Surface Determinant Protein OA3, Rh-Related Antigen |
| Reference | PX-P4008 |
| Note | For research use only |
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.