Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human KELCH Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q8WZ60
Molecular weight:
30 kDa

Original price was: €239.00.Current price is: €210.00.

50ug 12% OFF + 210 loyalty points
Partial His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human KELCH Recombinant Protein

Product name Human KELCH Recombinant Protein
Uniprot ID Q8WZ60
Uniprot link http://www.uniprot.org/uniprot/Q8WZ60
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence (Sequence without tag) KKWVEFACVTLKNEVYISGGKETQHDVWKYNSSINKWIQIEYLNIGRWRHKMVVLGGKVYVIGGFDGLQRINNVETYDPFHNCWSEAAPLLVHVSSFAATSHKKKLYVIGGGPNGKLATDKTQCYDPSTNKWSLKAAMPVEAKCINAVSFRDRIYVVGGAMRALYAYSPLEDSWCLVTQLSHERASCGIAPCNNRLYITGGRDEKNEVIATVLCWDPEAQKLTEECVLPRGVSHHGSVTIRKSYTHIRRIVPGAVSV
Molecular weight 30 kDa
Protein delivered with Tag? His
Purity estimated 90% (full length + degradation)
Buffer PBS, Urea 4M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAH32348.1
Spec:Entrez GeneID 89857
Spec:SwissProtID Q8WZ60
NCBI Reference AAH32348.1
Aliases /Synonyms KELCH, kelch-like 6
Reference PX-P1118
Note For research use only
Molecular Constructor
Partial His
Product name Human KELCH Recombinant Protein
Uniprot ID Q8WZ60
Uniprot link http://www.uniprot.org/uniprot/Q8WZ60
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence (Sequence without tag) KKWVEFACVTLKNEVYISGGKETQHDVWKYNSSINKWIQIEYLNIGRWRHKMVVLGGKVYVIGGFDGLQRINNVETYDPFHNCWSEAAPLLVHVSSFAATSHKKKLYVIGGGPNGKLATDKTQCYDPSTNKWSLKAAMPVEAKCINAVSFRDRIYVVGGAMRALYAYSPLEDSWCLVTQLSHERASCGIAPCNNRLYITGGRDEKNEVIATVLCWDPEAQKLTEECVLPRGVSHHGSVTIRKSYTHIRRIVPGAVSV
Molecular weight 29 kDa
Protein delivered with Tag? His
Purity estimated 90% (full length + degradation)
Buffer PBS, Urea 4M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAH32348.1
Spec:Entrez GeneID 89857
Spec:SwissProtID Q8WZ60
NCBI Reference AAH32348.1
Aliases /Synonyms KELCH, kelch-like 6
Reference PX-P1118
Note For research use only
Molecular Constructor
Partial His
Product name PX-P1118-1MG
Uniprot ID Q8WZ60
Uniprot link http://www.uniprot.org/uniprot/Q8WZ60
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence (Sequence without tag) KKWVEFACVTLKNEVYISGGKETQHDVWKYNSSINKWIQIEYLNIGRWRHKMVVLGGKVYVIGGFDGLQRINNVETYDPFHNCWSEAAPLLVHVSSFAATSHKKKLYVIGGGPNGKLATDKTQCYDPSTNKWSLKAAMPVEAKCINAVSFRDRIYVVGGAMRALYAYSPLEDSWCLVTQLSHERASCGIAPCNNRLYITGGRDEKNEVIATVLCWDPEAQKLTEECVLPRGVSHHGSVTIRKSYTHIRRIVPGAVSV
Molecular weight 30 kDa
Protein delivered with Tag? His
Purity estimated 90% (full length + degradation)
Buffer PBS, Urea 4M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAH32348.1
Spec:Entrez GeneID 89857
Spec:SwissProtID Q8WZ60
NCBI Reference AAH32348.1
Aliases /Synonyms KELCH, kelch-like 6
Reference PX-P1118
Note For research use only
Molecular Constructor
Partial His

Human KELCH Recombinant Protein

There are no reviews yet.

Be the first to review “Human KELCH Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products