Cart (0 Items)
Your cart is currently empty.
View ProductsHuman IL22 Recombinant Protein
| Size | 100ug, 20ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Human IL22 Recombinant Protein |
|---|---|
| Uniprot ID | Q9GZX6 |
| Uniprot link | http://www.uniprot.org/uniprot/ Q9GZX6 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | MVAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACILEHHHHHH |
| Molecular weight | 18.04 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 90% |
| Buffer | PBS,pH 7.5 urea +8M |
| Form | Frozen |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Applications | ELISA,WB |
| Fragment Type | Partial |
| NCBI Reference | Q9GZX6 |
| Aliases /Synonyms | ILTIF, Zcyto18, IL-TIF, IL-D110, TIFa, TIFIL-23, IL-22, Cytokine Zcyto18, IL-10-Related T-Cell-Derived Inducible Factor |
| Reference | PX-P3032 |
| Note | For research use only |
Related products
Biosimilar
Fezakinumab Biosimilar – Anti-IL22 mAb – Research Grade
PX-TA1232 400€Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.