Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human IL20RB recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q6UXL0
Molecular weight:
30.82 kDa

329.00

100ug + 329 loyalty points
His Ala37–Glu290
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Human IL20RB recombinant protein

Human IL20RB recombinant protein

Product name Human IL20RB recombinant protein
Uniprot ID Q6UXL0
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence APQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEAIPLVLALFAFVGFMLILVVVPLFVWKMGRLLQYSCCPVVVLPDTLKITNSPQKLISCRRE
Molecular weight 30.82 kDa
Protein delivered with Tag? N-Terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala37-Glu290
Aliases /Synonyms IL-20R-beta, IL-20R2, FNDC6, IL-20RB, DIRS1, IL20RB, Interleukin-20 receptor subunit beta, Fibronectin type III domain containing 6, IL-20 receptor subunit beta
Reference PX-P6279
Note For research use only
Molecular Constructor
His Ala37–Glu290

Human IL20RB recombinant protein

There are no reviews yet.

Be the first to review “Human IL20RB recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products