Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human IL2 recombinant protein (1-134)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P60568
Molecular weight:
16.48 kDa

€329.00

100 ug + 329 loyalty points
Met1–Thr134 His
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Human IL2 recombinant protein (1-134)

Human IL2 recombinant protein (1-134)

Product name Human IL2 recombinant protein (1-134)
Uniprot ID P60568
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMCEYADE
Molecular weight 16.48 kDa
Protein delivered with Tag? C-Terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol
Delivery condition Blue ice (+4°)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Thr134
Aliases /Synonyms TCGF, Aldesleukin, T-cell growth factor, Interleukin-2, IL-2
Reference PX-P6288
Note For research use only.
Molecular Constructor
Met1–Thr134 His

Human IL2 recombinant protein (1-134)

There are no reviews yet.

Be the first to review “Human IL2 recombinant protein (1-134)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products