Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Human HSP110de9 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Molecular weight:
43,46 kDa

€210.00

+ 210 loyalty points
Partial Yes
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Human HSP110de9 Recombinant Protein

Human HSP110de9 Recombinant Protein

Product name Human HSP110de9 Recombinant Protein
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLMSVVGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQQITHANNTVSNFKR FHGRAFNDPFIQKEKENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAMLLTKLKETAENSLKKPVTDCVISVPSFFT DAERRSVLDAAQIVGLNCLRLMNDMTAVALNYGIYKQDLPSLDEKPRIVVFVDMGHSAFQVSACAFNKGKLKVLGTAFDP FLGGKNFDEKLVEHFCAEFKTKYKLDAKSKIRALLRLYQECEKLKKLMSSNSTDLPLNIECFMNDKDVSGKMNRSQFEEL CAELLQKIEVPLYSLLEQTHLKVEDVSAVEIVGGATRIPAVKERIAKFFGKDISTTLNADEAVARGCALQCS
Molecular weight 43,46 kDa
Protein delivered with Tag? Yes
Purity estimated >95%
Buffer PBS, Urea 6M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession /*
NCBI Reference /*
Aliases /Synonyms HSP110de9, heat shock 105kDa protein mutant de9
Reference PX-P1112
Note For research use only
Molecular Constructor
Partial Yes
Product name Human HSP110de9 Recombinant Protein
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLMSVVGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQQITHANNTVSNFKR FHGRAFNDPFIQKEKENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAMLLTKLKETAENSLKKPVTDCVISVPSFFT DAERRSVLDAAQIVGLNCLRLMNDMTAVALNYGIYKQDLPSLDEKPRIVVFVDMGHSAFQVSACAFNKGKLKVLGTAFDP FLGGKNFDEKLVEHFCAEFKTKYKLDAKSKIRALLRLYQECEKLKKLMSSNSTDLPLNIECFMNDKDVSGKMNRSQFEEL CAELLQKIEVPLYSLLEQTHLKVEDVSAVEIVGGATRIPAVKERIAKFFGKDISTTLNADEAVARGCALQCS
Molecular weight 43,46 kDa
Protein delivered with Tag? Yes
Purity estimated >95%
Buffer PBS, Urea 6M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession /*
NCBI Reference /*
Aliases /Synonyms HSP110de9, heat shock 105kDa protein mutant de9
Reference PX-P1112
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Human HSP110de9 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products