Name: Human Gastrin-releasing peptide(PROGRP) Recombinant Protein
SKU: PX-P3006-10
Availability: InStock

Product name	Human Gastrin-releasing peptide(PROGRP) Recombinant Protein
Uniprot ID	H0Y5C5
Uniprot link	http://www.uniprot.org/uniprot/H0Y5C5
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	LEVLFQGPSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKD
Molecular weight	34.58 kDa
Protein delivered with Tag?	Yes
Purity estimated	40%
Buffer	PBS, pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Partial
NCBI Reference	H0Y5C5
Aliases /Synonyms	pro-GRP, preproGRP, pre-proGRP,Pro-Gastrin Releasing Peptide, ProGRP
Reference	PX-P3006
Note	For research use only

No Products found