Brand: ProteoGenix

Human Gal9 recombinant protein

PX-P6440-50
Quality Chart

Host species:: Mammalian cells
Origin species:: Human
Uniprot ID:: O00182
Molecular weight:: 63.34 kDa

Original price was: €305.00.Current price is: €277.00.

50ug 9% OFF + 277 loyalty points

Fc Ala2–Thr355

Size Size

50ug Original price was: €305.00.Current price is: €277.00.
100ug Original price was: €435.00.Current price is: €395.00.
1MG Original price was: €1,375.00.Current price is: €1,146.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Human Gal9 recombinant protein

Product name	PX-P6440-100
Uniprot ID	O00182
Origin species	Human
Expression system	Eukaryotic expression
Raw Antigen Sequence	AFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQNPRTVPVQPAFSTVPFSQPVCFPPRPRGRRQKPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT
Molecular weight	63.34 kDa
Protein delivered with Tag?	N-Terminal Fc Tag
Buffer	PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Ala2-Thr355
Aliases /Synonyms	Gal-9, Ecalectin, Tumor antigen HOM-HD-21, LGALS9Galectin-9,
Reference	PX-P6440
Molecular Constructor	Fc Ala2–Thr355

Product name	PX-P6440-1MG
Uniprot ID	O00182
Origin species	Human
Expression system	Eukaryotic expression
Raw Antigen Sequence	AFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQNPRTVPVQPAFSTVPFSQPVCFPPRPRGRRQKPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT
Molecular weight	63.34 kDa
Protein delivered with Tag?	N-Terminal Fc Tag
Buffer	PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Ala2-Thr355
Aliases /Synonyms	Gal-9, Ecalectin, Tumor antigen HOM-HD-21, LGALS9Galectin-9,
Reference	PX-P6440
Molecular Constructor	Fc Ala2–Thr355

Product name	PX-P6440-50
Uniprot ID	O00182
Origin species	Human
Expression system	Eukaryotic expression
Raw Antigen Sequence	AFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQNPRTVPVQPAFSTVPFSQPVCFPPRPRGRRQKPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT
Molecular weight	63.34 kDa
Protein delivered with Tag?	N-Terminal Fc Tag
Buffer	PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Ala2-Thr355
Aliases /Synonyms	Gal-9, Ecalectin, Tumor antigen HOM-HD-21, LGALS9Galectin-9,
Reference	PX-P6440
Molecular Constructor	Fc Ala2–Thr355