Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human FLT1 recombinant protein

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P17948
Molecular weight:
62.57 kDa

Original price was: €313.00.Current price is: €277.00.

50ug 12% OFF + 277 loyalty points
Met1–Val232 Fc
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Human FLT1 recombinant protein

Human FLT1 recombinant protein

Product name PX-P6533-100
Uniprot ID P17948
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDV
Molecular weight 62.57 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Val232
Aliases /Synonyms Vascular endothelial growth factor receptor 1, VEGFR1, Vascular permeability factor receptor, FRT, Tyrosine-protein kinase receptor FLT, VEGFR-1, FLT, FLT-1, Tyrosine-protein kinase FRT, Fms-like tyrosine kinase 1FLT1,
Reference PX-P6533
Molecular Constructor
Met1–Val232 Fc
Product name PX-P6533-1MG
Uniprot ID P17948
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDV
Molecular weight 62.57 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Val232
Aliases /Synonyms Vascular endothelial growth factor receptor 1, VEGFR1, Vascular permeability factor receptor, FRT, Tyrosine-protein kinase receptor FLT, VEGFR-1, FLT, FLT-1, Tyrosine-protein kinase FRT, Fms-like tyrosine kinase 1FLT1,
Reference PX-P6533
Molecular Constructor
Met1–Val232 Fc
Product name PX-P6533-50
Uniprot ID P17948
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDV
Molecular weight 62.57 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Val232
Aliases /Synonyms Vascular endothelial growth factor receptor 1, VEGFR1, Vascular permeability factor receptor, FRT, Tyrosine-protein kinase receptor FLT, VEGFR-1, FLT, FLT-1, Tyrosine-protein kinase FRT, Fms-like tyrosine kinase 1FLT1,
Reference PX-P6533
Molecular Constructor
Met1–Val232 Fc

There are no reviews yet.

Be the first to review “Human FLT1 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products