Name: Human FGF2b Recombinant Protein
SKU: PX-P1089-10
Availability: InStock

Wide range of unique reagents
Free shipping in EU on Orders > €500
Fast worldwide delivery

size	100ug, 50ug
Brand	ProteoGenix
Product type	Recombinant Proteins
Host Species	Escherichia coli (E. coli)
Applications	Elisa, WB

Cancer Signal Transduction Developmental Biology

Product name	Human FGF2b Recombinant Protein
Uniprot ID	P09038
Uniprot link	http://www.uniprot.org/uniprot/P09038
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	MAHNHRHKHKLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVC ANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Molecular weight	17,76 kDa
Protein delivered with Tag?	Yes
Purity estimated	90%
Buffer	PBS, Urea 8M
Form	liquid
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Partial
Protein Accession	AAA52534.1
Spec:Entrez GeneID	2247
Spec:NCBI Gene Aliases	FGFB, HBGF-2, FGF-2, BFGF
Spec:SwissProtID	P09038
NCBI Reference	AAA52534.1
Aliases /Synonyms	FGF2b, basic fibroblast Growth Factor proteins, FGF2, Fibroblast Growth Factor proteins 2, FGF-2, bFGF, Heparin-binding Growth Factor proteins 2, HBGF-2
Reference	PX-P1089
Note	For research use only

Datasheet Download

MSDS Download

Publication

1: Wróbel T, Butrym A, Łacina P, Rybka J, Gębura K, Mazur G, Bogunia-Kubik K. bFGF Polymorphism Is Associated with Disease Progression and Response to Chemotherapy in Multiple Myeloma Patients. Anticancer Res. 2017 Apr;37(4):1799-1803. PubMed PMID: 28373444.
2: Neutralizing Monoclonal Antibody 3B1 Against Human Basic Fibroblast Growth Factor. Monoclon Antib Immunodiagn Immunother. 2016 Apr;35(2):122. doi: 10.1089/mab.2015.0080. PubMed PMID: 27097071.
3: Hao RH, Guo Y, Dong SS, Weng GZ, Yan H, Zhu DL, Chen XF, Chen JB, Yang TL. Associations of Plasma FGF2 Levels and Polymorphisms in the FGF2 Gene with Obesity Phenotypes in Han Chinese Population. Sci Rep. 2016 Feb 16;6:19868. doi: 10.1038/srep19868. PubMed PMID: 26879180; PubMed Central PMCID: PMC4754629.
4: Shi H, Xu J, Zhao R, Wu H, Gu L, Chen Y. FGF2 regulates proliferation, migration, and invasion of ECA109 cells through PI3K/Akt signalling pathway in vitro. Cell Biol Int. 2016 May;40(5):524-33. doi: 10.1002/cbin.10588. Epub 2016 Mar 9. PubMed PMID: 26833879.
5: Hu M, Hu Y, He J, Li B. Prognostic Value of Basic Fibroblast Growth Factor proteins (bFGF) in Lung Cancer: A Systematic Review with Meta-Analysis. PLoS One. 2016 Jan 29;11(1):e0147374. doi: 10.1371/journal.pone.0147374. eCollection 2016. Review. PubMed PMID: 26824699; PubMed Central PMCID: PMC4732945.
6: Ye L, Yang Y, Zhang X, Cai P, Li R, Chen D, Wei X, Zhang X, Xu H, Xiao J, Li X, Lin L, Zhang H. The Role of bFGF in the Excessive Activation of Astrocytes Is Related to the Inhibition of TLR4/NFκB Signals. Int J Mol Sci. 2015 Dec 28;17(1). pii: E37. doi: 10.3390/ijms17010037. PubMed PMID: 26729092; PubMed Central PMCID: PMC4730282.
7: Twaroski K, Mallanna SK, Jing R, DiFurio F, Urick A, Duncan SA. FGF2 mediates hepatic progenitor cell formation during human pluripotent stem cell differentiation by inducing the WNT antagonist NKD1. Genes Dev. 2015 Dec 1;29(23):2463-74. doi: 10.1101/gad.268961.115. PubMed PMID: 26637527; PubMed Central PMCID: PMC4691950.
8: Lim S, Cho H, Lee E, Won Y, Kim C, Ahn W, Lee E, Son Y. Osteogenic stimulation of human adipose-derived stem cells by pre-treatment with fibroblast growth factor 2. Cell Tissue Res. 2016 Apr;364(1):137-47. doi: 10.1007/s00441-015-2311-8. Epub 2015 Nov 7. PubMed PMID: 26547859.
9: Chen Y, Zhu G, Wu K, Gao Y, Zeng J, Shi Q, Guo P, Wang X, Chang LS, Li L, He D. FGF2-mediated reciprocal tumor cell-endothelial cell interplay contributes to the growth of chemoresistant cells: a potential mechanism for superficial bladder cancer recurrence. Tumour Biol. 2016 Apr;37(4):4313-21. doi: 10.1007/s13277-015-4214-4. Epub 2015 Oct 22. PubMed PMID: 26493998.
10: Zhao W, Yu H, Han Z, Gao N, Xue J, Wang Y. Clinical significance of joint detection of serum CEA, SCCA, and bFGF in the diagnosis of lung cancer. Int J Clin Exp Pathol. 2015 Aug 1;8(8):9506-11. eCollection 2015. PubMed PMID: 26464712; PubMed Central PMCID: PMC4583944.
11: Litwin M, Radwańska A, Paprocka M, Kieda C, Dobosz T, Witkiewicz W, Baczyńska D. The role of FGF2 in migration and tubulogenesis of endothelial progenitor cells in relation to pro-angiogenic Growth Factor proteins production. Mol Cell Biochem. 2015 Dec;410(1-2):131-42. doi: 10.1007/s11010-015-2545-5. Epub 2015 Aug 28. PubMed PMID: 26314253.
12: Fessler E, Borovski T, Medema JP. Endothelial cells induce cancer stem cell features in differentiated glioblastoma cells via bFGF. Mol Cancer. 2015 Aug 19;14:157. doi: 10.1186/s12943-015-0420-3. PubMed PMID: 26282129; PubMed Central PMCID: PMC4539660.
13: Jerebtsova M, Das JR, Tang P, Wong E, Ray PE. Angiopoietin-1 prevents severe bleeding complications induced by heparin-like drugs and fibroblast growth factor-2 in mice. Am J Physiol Heart Circ Physiol. 2015 Oct;309(8):H1314-25. doi: 10.1152/ajpheart.00373.2015. Epub 2015 Aug 14. PubMed PMID: 26276817; PubMed Central PMCID: PMC4666966.
14: Hurley MM, Adams DJ, Wang L, Jiang X, Burt PM, Du E, Xiao L. Accelerated fracture healing in transgenic mice overexpressing an anabolic isoform of fibroblast Growth Factor proteins 2. J Cell Biochem. 2016 Mar;117(3):599-611. doi: 10.1002/jcb.25308. PubMed PMID: 26252425.
15: Li S, Payne S, Wang F, Claus P, Su Z, Groth J, Geradts J, de Ridder G, Alvarez R, Marcom PK, Pizzo SV, Bachelder RE. Nuclear basic fibroblast growth factor regulates triple-negative breast cancer chemo-resistance. Breast Cancer Res. 2015 Jul 4;17:91. doi: 10.1186/s13058-015-0590-3. PubMed PMID: 26141457; PubMed Central PMCID: PMC4491247.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Human FGF2b Recombinant Protein”

Price and Availability

size

Clear

GET A QUOTE NOW

OK

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

Burosumab Biosimilar – Anti-FGF23 mAb – Research Grade

PX-TA1437 200€

View product

Human FGF2b Recombinant Protein

REVIEW YOUR PRODUCT

Burosumab Biosimilar – Anti-FGF23 mAb – Research Grade

Contact us

Cart (0 Items)