Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human FGF14 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q92915
Molecular weight:
29.73 kDa

€210.00

50ug + 210 loyalty points
Partial Yes
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Human FGF14 Recombinant Protein

Human FGF14 Recombinant Protein

Product name Human FGF14 Recombinant Protein
Uniprot ID Q92915
Uniprot link http://www.uniprot.org/uniprot/ Q92915
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MAMVKPVPLFRRTDFKLLLCNHKDLFFLRVSKLLDCFSPKSMWFLWNIFSKGTHMLQCLCGKSLKKNKNPTDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKTTLEHHHHHH
Molecular weight 29.73 kDa
Protein delivered with Tag? Yes
Purity estimated 70%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
NCBI Reference Q92915
Aliases /Synonyms FHF4, SCA27, Fibroblast Growth Factor proteins homologous factor 4,Active Fibroblast Growth Factor proteins 14
Reference PX-P3031
Note For research use only
Molecular Constructor
Partial Yes
Product name Human FGF14 Recombinant Protein
Uniprot ID Q92915
Uniprot link http://www.uniprot.org/uniprot/ Q92915
Origin species Homo sapiens (Human)
Expression system Procaryotic expression
Sequence MAMVKPVPLFRRTDFKLLLCNHKDLFFLRVSKLLDCFSPKSMWFLWNIFSKGTHMLQCLCGKSLKKNKNPTDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKTTLEHHHHHH
Molecular weight 29.73 kDa
Protein delivered with Tag? Yes
Purity estimated 70%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
NCBI Reference Q92915
Aliases /Synonyms FHF4, SCA27, Fibroblast growth factor homologous factor 4,Active Fibroblast Growth Factor 14
Reference PX-P3031
Note For research use only
Molecular Constructor
Partial Yes
Product name Human FGF14 Recombinant Protein
Uniprot ID Q92915
Uniprot link http://www.uniprot.org/uniprot/ Q92915
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MAMVKPVPLFRRTDFKLLLCNHKDLFFLRVSKLLDCFSPKSMWFLWNIFSKGTHMLQCLCGKSLKKNKNPTDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKTTLEHHHHHH
Molecular weight 29.73 kDa
Protein delivered with Tag? Yes
Purity estimated 70%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
NCBI Reference Q92915
Aliases /Synonyms FHF4, SCA27, Fibroblast Growth Factor proteins homologous factor 4,Active Fibroblast Growth Factor proteins 14
Reference PX-P3031
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Human FGF14 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products