Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human FCGRT/FCRN (SAA0136) Monoclonal Antibody

Original price was: €300.00.Current price is: €231.00.

50ug 23% OFF + 231 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human FCGRT/FCRN (SAA0136) Monoclonal Antibody

Product name ARO-A16096-100
Uniprot ID P55899
Uniprot link P55899
Raw Antigen Sequence MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNVIPATA
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms IgG Fc fragment receptor transporter alpha chain, IgG receptor FcRn large subunit p51, FcRn, FCGRT, FCRN, Neonatal Fc receptor
Reference ARO-A16096
Isotype IgG4, Kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen FCGRT/FCRN (SAA0136)
Clone Name SAA0136
Protein Name FCGRT/FCRN (SAA0136)
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16096-1MG
Uniprot ID P55899
Uniprot link P55899
Raw Antigen Sequence MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNVIPATA
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms IgG Fc fragment receptor transporter alpha chain, IgG receptor FcRn large subunit p51, FcRn, FCGRT, FCRN, Neonatal Fc receptor
Reference ARO-A16096
Isotype IgG4, Kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen FCGRT/FCRN (SAA0136)
Clone Name SAA0136
Protein Name FCGRT/FCRN (SAA0136)
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16096-50
Uniprot ID P55899
Uniprot link P55899
Raw Antigen Sequence MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNVIPATA
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms IgG Fc fragment receptor transporter alpha chain, IgG receptor FcRn large subunit p51, FcRn, FCGRT, FCRN, Neonatal Fc receptor
Reference ARO-A16096
Isotype IgG4, Kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen FCGRT/FCRN (SAA0136)
Clone Name SAA0136
Protein Name FCGRT/FCRN (SAA0136)
Target species Anti-Human Monoclonal Antibody

Human FCGRT/FCRN (SAA0136) Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human FCGRT/FCRN (SAA0136) Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products