Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human FAP protein (Ile523-Asp760)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q12884
Molecular weight:
27.55 kDa

182.00

50ug + 182 loyalty points
Ile523–Asp760 His
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human FAP protein (Ile523-Asp760)

Product name Human FAP protein
Uniprot ID Q12884
Uniprot link https://www.uniprot.org/uniprot/Q12884
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence ILPPQFDRSKKYPLLIQVYGGPCSQSVRSVFAVNWISYLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQITAVRKFIEMGFIDEKRIAIWGWSYGGYVSSLALASGTGLFKCGIAVAPVSSWEYYASVYTERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTADDNVHFQNSAQIAKALVNAQVDFQAMWYSDQNHGLSGLSTNHLYTHMTHFLKQCFSLSD
Molecular weight 27.55 kDa
Protein delivered with Tag? His Tag
Purity estimated >90%
Buffer PBS,pH7.5
Form Frozen Liquid or Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile523-Asp760
Spec:Entrez GeneID 2191
Spec:NCBI Gene Aliases FAPA; SIMP; DPPIV; FAPalpha
Spec:SwissProtID Q12884
Aliases /Synonyms Prolyl endopeptidase FAP,Prolyl endopeptidase FAP,Dipeptidyl peptidase FAP,Fibroblast activation protein alpha,FAPalpha,Gelatine degradation protease FAP,Integral membrane serine protease,Post-proline cleaving enzyme,Serine integral membrane protease,SIMP,Surface-expressed protease,Seprase
Reference PX-P4887
Note For research use only
Molecular Constructor
Ile523–Asp760 His
Product name Human FAP protein
Uniprot ID Q12884
Uniprot link https://www.uniprot.org/uniprot/Q12884
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence ILPPQFDRSKKYPLLIQVYGGPCSQSVRSVFAVNWISYLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQITAVRKFIEMGFIDEKRIAIWGWSYGGYVSSLALASGTGLFKCGIAVAPVSSWEYYASVYTERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTADDNVHFQNSAQIAKALVNAQVDFQAMWYSDQNHGLSGLSTNHLYTHMTHFLKQCFSLSD
Molecular weight 27.55 kDa
Protein delivered with Tag? His Tag
Purity estimated >90%
Buffer PBS,pH7.5
Form Frozen Liquid or Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile523-Asp760
Spec:Entrez GeneID 2191
Spec:NCBI Gene Aliases FAPA; SIMP; DPPIV; FAPalpha
Spec:SwissProtID Q12884
Aliases /Synonyms Prolyl endopeptidase FAP,Prolyl endopeptidase FAP,Dipeptidyl peptidase FAP,Fibroblast activation protein alpha,FAPalpha,Gelatine degradation protease FAP,Integral membrane serine protease,Post-proline cleaving enzyme,Serine integral membrane protease,SIMP,Surface-expressed protease,Seprase
Reference PX-P4887
Note For research use only
Molecular Constructor
Ile523–Asp760 His

General information on Human FAP protein

Human FAP protein (Ile523-Asp760)

There are no reviews yet.

Be the first to review “Human FAP protein (Ile523-Asp760)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products