Brand: ProteoGenix

Human CGA recombinant protein

PX-P6562-50
Quality Chart

Host species:: Mammalian cells
Origin species:: Human
Uniprot ID:: P01215 & P01225
Molecular weight:: 39.20 kDa

Original price was: €224.00.Current price is: €193.00.

50ug 14% OFF + 193 loyalty points

Ala25–Ser116 Fc

Size Size

50ug Original price was: €224.00.Current price is: €193.00.
100ug Original price was: €347.00.Current price is: €275.00.
1MG Original price was: €982.00.Current price is: €798.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Human CGA recombinant protein

Product name	PX-P6562-100
Uniprot ID	P01215 & P01225
Origin species	Human
Expression system	Eukaryotic expression
Raw Antigen Sequence	APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
Molecular weight	39.20 kDa
Protein delivered with Tag?	C-Terminal Fc Tag
Buffer	PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Ala25-Ser116
Aliases /Synonyms	Lutropin alpha chain, Thyrotropin alpha chain, Follitropin alpha chain, Luteinizing hormone alpha chain, Thyroid-stimulating hormone alpha chain, FSH-alpha, LSH-alpha, Glycoprotein hormones alpha chain, CGA, TSH-alpha, Choriogonadotropin alpha chain, Anterior pituitary glycoprotein hormones common subunit alpha, CG-alpha, Chorionic gonadotrophin subunit alphaFollicle-stimulating hormone alpha chain,
Reference	PX-P6562
Molecular Constructor	Ala25–Ser116 Fc

Product name	PX-P6562-1MG
Uniprot ID	P01215 & P01225
Origin species	Human
Expression system	Eukaryotic expression
Raw Antigen Sequence	APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
Molecular weight	39.20 kDa
Protein delivered with Tag?	C-Terminal Fc Tag
Buffer	PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Ala25-Ser116
Aliases /Synonyms	Lutropin alpha chain, Thyrotropin alpha chain, Follitropin alpha chain, Luteinizing hormone alpha chain, Thyroid-stimulating hormone alpha chain, FSH-alpha, LSH-alpha, Glycoprotein hormones alpha chain, CGA, TSH-alpha, Choriogonadotropin alpha chain, Anterior pituitary glycoprotein hormones common subunit alpha, CG-alpha, Chorionic gonadotrophin subunit alphaFollicle-stimulating hormone alpha chain,
Reference	PX-P6562
Molecular Constructor	Ala25–Ser116 Fc

Product name	PX-P6562-50
Uniprot ID	P01215 & P01225
Origin species	Human
Expression system	Eukaryotic expression
Raw Antigen Sequence	APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
Molecular weight	39.20 kDa
Protein delivered with Tag?	C-Terminal Fc Tag
Buffer	PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Ala25-Ser116
Aliases /Synonyms	Lutropin alpha chain, Thyrotropin alpha chain, Follitropin alpha chain, Luteinizing hormone alpha chain, Thyroid-stimulating hormone alpha chain, FSH-alpha, LSH-alpha, Glycoprotein hormones alpha chain, CGA, TSH-alpha, Choriogonadotropin alpha chain, Anterior pituitary glycoprotein hormones common subunit alpha, CG-alpha, Chorionic gonadotrophin subunit alphaFollicle-stimulating hormone alpha chain,
Reference	PX-P6562
Molecular Constructor	Ala25–Ser116 Fc