Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD48 Monoclonal Antibody

  • ARO-A15842-100
  • Validated WB

Original price was: €536.00.Current price is: €391.00.

100ug 27% OFF + 391 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD48 Monoclonal Antibody

Product name ARO-A15842-100
Uniprot ID P09326
Uniprot link P09326
Raw Antigen Sequence MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSFGVEWIASWLVVTVPTILGLLLT
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Signaling lymphocytic activation molecule 2, TCT.1, CD48 antigen, B-lymphocyte activation marker BLAST-1, BCM1, CD48, BLAST1, Leukocyte antigen MEM-102, SLAMF2, BCM1 surface antigen, SLAM family member 2
Reference ARO-A15842
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD48
Clone Name SAA0017
Protein Name CD48
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15842-1MG
Uniprot ID P09326
Uniprot link P09326
Raw Antigen Sequence MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSFGVEWIASWLVVTVPTILGLLLT
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Signaling lymphocytic activation molecule 2, TCT.1, CD48 antigen, B-lymphocyte activation marker BLAST-1, BCM1, CD48, BLAST1, Leukocyte antigen MEM-102, SLAMF2, BCM1 surface antigen, SLAM family member 2
Reference ARO-A15842
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD48
Clone Name SAA0017
Protein Name CD48
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15842-50
Uniprot ID P09326
Uniprot link P09326
Raw Antigen Sequence MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSFGVEWIASWLVVTVPTILGLLLT
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Signaling lymphocytic activation molecule 2, TCT.1, CD48 antigen, B-lymphocyte activation marker BLAST-1, BCM1, CD48, BLAST1, Leukocyte antigen MEM-102, SLAMF2, BCM1 surface antigen, SLAM family member 2
Reference ARO-A15842
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD48
Clone Name SAA0017
Protein Name CD48
Target species Anti-Human Monoclonal Antibody

Human CD48 Monoclonal Antibody binds to Mouse CD48 Recombinant Protein, C-His in WB Assay

Human CD48 Monoclonal Antibody binds to Mouse CD48 Recombinant Protein, C-His in WB Assay

Mouse CD48 Recombinant Protein, C-His(cat. No.ARO-P21264) can bind Human CD48 Monoclonal Antibody in Western Blot Assay as detected on gel analysis.

Human CD48 Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD48 Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products