Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD299-CLEC4M recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q9H2X3
Molecular weight:
64.83 kDa

379.00

100ug + 379 loyalty points
Fc Ser78–Glu399
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD299-CLEC4M recombinant protein

Product name Human CD299-CLEC4M recombinant protein
Uniprot ID Q9H2X3
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence SLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE
Molecular weight 64.83 kDa
Protein delivered with Tag? N-Terminal Fc Tag
Purity estimated >85% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser78-Glu399
Aliases /Synonyms DC-SIGNR, DC-SIGN2, CLEC4M, DC-SIGN-related protein, C-type lectin domain family 4 member M, CD299, L-SIGN, CD209L, Liver/lymph node-specific ICAM-3-grabbing non-integrin, CD209L1, Dendritic cell-specific ICAM-3-grabbing non-integrin 2, CD209 antigen-like protein 1
Reference PX-P6226
Note For research use only
Molecular Constructor
Fc Ser78–Glu399

Human CD299-CLEC4M recombinant protein

There are no reviews yet.

Be the first to review “Human CD299-CLEC4M recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products