Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD209 recombinant protein in mammalian cells

Note:
For research use only.

420.00

100 ug + 420 loyalty points
Lys62–Ala404 His
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Human CD209 recombinant protein in mammalian cells

Human CD209 recombinant protein in mammalian cells

Product name Human CD209 recombinant protein in mammalian cells
Uniprot ID Q9NNX6
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence KVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA
Molecular weight 42.3 kDa
Protein delivered with Tag? C-Terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol
Form Lyophilized
Delivery condition Blue ice (+4°)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Store at 2 to 8 °C for one week or at -20 to -80 °C for one year
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Lys62-Ala404
Aliases /Synonyms DC-SIGN1, CD209 antigen, CLEC4L, DC-SIGN, C-type lectin domain family 4 member L, Dendritic cell-specific ICAM-3-grabbing non-integrin 1
Reference PX-P6286
Note For research use only.
Molecular Constructor
Lys62–Ala404 His

Human CD209 recombinant protein in mammalian cells

There are no reviews yet.

Be the first to review “Human CD209 recombinant protein in mammalian cells”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products