Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD158/KIR Monoclonal Antibody

Original price was: €168.00.Current price is: €132.00.

50ug 21% OFF + 132 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD158/KIR Monoclonal Antibody

Product name ARO-A16049-100
Uniprot ID P43626, P43627, P43632
Uniprot link P43626/P43627/P43632
Raw Antigen Sequence MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSWEPSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGGKGGSCSQAACSNSAQGSDESLITCKA
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms CD158 antigen-like family member A, KIR2DL1, Killer cell immunoglobulin-like receptor 2DL1, Natural killer-associated transcript 1, NKAT-1, MHC class I NK cell receptor, CD158A, p58 natural killer cell receptor clones CL-42/47.11, CD158a, p58.1 MHC class-I-specific NK receptor, NKAT1, p58 NK receptor CL-42/47.11, p58 NK receptor CL-43, NKAT-6, NKAT6, MHC class I NK cell receptor, CD158 antigen-like family member B1, CD158b1, p58 natural killer cell receptor clone CL-43, Natural killer-associated transcript 6, CD158B1, KIR2DL2, Killer cell immunoglobulin-like receptor 2DL2, P58 natural killer cell receptor clones CL-39/CL-17, CD158i, MHC class I NK cell receptor, CD158I, p58 NK receptor CL-39/CL-17, NKAT8, KKA3, NKAT-8, CD158 antigen-like family member I, Killer cell immunoglobulin-like receptor 2DS4, Natural killer-associated transcript 8, KIR2DS4
Reference ARO-A16049
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD158/KIR
Clone Name NKVFS1
Protein Name CD158/KIR
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16049-1MG
Uniprot ID P43626, P43627, P43632
Uniprot link P43626/P43627/P43632
Raw Antigen Sequence MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSWEPSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGGKGGSCSQAACSNSAQGSDESLITCKA
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms CD158 antigen-like family member A, KIR2DL1, Killer cell immunoglobulin-like receptor 2DL1, Natural killer-associated transcript 1, NKAT-1, MHC class I NK cell receptor, CD158A, p58 natural killer cell receptor clones CL-42/47.11, CD158a, p58.1 MHC class-I-specific NK receptor, NKAT1, p58 NK receptor CL-42/47.11, p58 NK receptor CL-43, NKAT-6, NKAT6, MHC class I NK cell receptor, CD158 antigen-like family member B1, CD158b1, p58 natural killer cell receptor clone CL-43, Natural killer-associated transcript 6, CD158B1, KIR2DL2, Killer cell immunoglobulin-like receptor 2DL2, P58 natural killer cell receptor clones CL-39/CL-17, CD158i, MHC class I NK cell receptor, CD158I, p58 NK receptor CL-39/CL-17, NKAT8, KKA3, NKAT-8, CD158 antigen-like family member I, Killer cell immunoglobulin-like receptor 2DS4, Natural killer-associated transcript 8, KIR2DS4
Reference ARO-A16049
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD158/KIR
Clone Name NKVFS1
Protein Name CD158/KIR
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16049-50
Uniprot ID P43626, P43627, P43632
Uniprot link P43626/P43627/P43632
Raw Antigen Sequence MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSWEPSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGGKGGSCSQAACSNSAQGSDESLITCKA
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms CD158 antigen-like family member A, KIR2DL1, Killer cell immunoglobulin-like receptor 2DL1, Natural killer-associated transcript 1, NKAT-1, MHC class I NK cell receptor, CD158A, p58 natural killer cell receptor clones CL-42/47.11, CD158a, p58.1 MHC class-I-specific NK receptor, NKAT1, p58 NK receptor CL-42/47.11, p58 NK receptor CL-43, NKAT-6, NKAT6, MHC class I NK cell receptor, CD158 antigen-like family member B1, CD158b1, p58 natural killer cell receptor clone CL-43, Natural killer-associated transcript 6, CD158B1, KIR2DL2, Killer cell immunoglobulin-like receptor 2DL2, P58 natural killer cell receptor clones CL-39/CL-17, CD158i, MHC class I NK cell receptor, CD158I, p58 NK receptor CL-39/CL-17, NKAT8, KKA3, NKAT-8, CD158 antigen-like family member I, Killer cell immunoglobulin-like receptor 2DS4, Natural killer-associated transcript 8, KIR2DS4
Reference ARO-A16049
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD158/KIR
Clone Name NKVFS1
Protein Name CD158/KIR
Target species Anti-Human Monoclonal Antibody

Human CD158/KIR Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD158/KIR Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products