Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD120b/TNFRSF1B/TNFR2 recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P20333
Molecular weight:
28.3 kDa

€319.00

100 ug + 319 loyalty points
Leu23–Asp257 His
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Human CD120b/TNFRSF1B/TNFR2 recombinant protein

Human CD120b/TNFRSF1B/TNFR2 recombinant protein

Product name Human CD120b/TNFRSF1B/TNFR2 recombinant protein
Uniprot ID P20333
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD
Molecular weight 28.3 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Store at 2 to 8 ℃ for one week. Store at -20 ℃ for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Leu23-Asp257
Aliases /Synonyms TNF-R2, TNFR-II, p80 TNF-alpha receptor, Etanercept, TNFBR, TBP-2, TBPII, Tumor necrosis factor receptor 2, TNF-RII, TNFR2, Tumor necrosis factor receptor type II, Tumor necrosis factor receptor superfamily member 1B, CD120b, p75, TNFRSF1B
Reference PX-P6584
Note For research use only.
Molecular Constructor
Leu23–Asp257 His

There are no reviews yet.

Be the first to review “Human CD120b/TNFRSF1B/TNFR2 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products