Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
  • Wide range of unique reagents
  • Free Shipping
    Free shipping in EU on Orders > €500
  • Fast worldwide delivery
    Fast worldwide delivery
Nycodenz AG® Nycodenz AG® XtenCHO ™ Race Starter kit XtenCHO ™ Race Starter kit
View all Products

Human Aggrecan (17-392) Recombinant Protein

Reference:
size

100ug, 50ug
Brand

ProteoGenix
Product type

Recombinant Proteins
Host Species

Escherichia coli (E. coli)
Applications

Elisa, WB
Tags:
Specification
Documents
Publications
Reviews
Product nameHuman Aggrecan (17-392) Recombinant Protein
Uniprot IDQ6PID9
Uniprot linkhttp://www.uniprot.org/uniprot/Q6PID9
Origin speciesHomo sapiens (Human)
Expression systemProkaryotic expression
SequenceMAHNHRHKHKLDDDDKAVTVETSDHDNSLSVSIPQPSPLRVLLGTSLTIPCYFIDPMHPVTTAPSTAPLAPRIKWSRVSK EKEVVLLVATEGRVRVNSAYQDKVSLPNYPAIPSDATLEVQSLRSNDSGVYRCEVMHGIEDSEATLEVVVKGIVFHYRAI STRYTLDFDRAQRACLQNSAIIATPEQLQAAYEDGFHQCDAGWLADQTVRYPIHTPREGCYGDKDEFPGVRTYGIRDTNE TYDVYCFAEEMEGEVFYATSPEKFTFQEAANECRRLGARLATTGQLYLAWQAGMDMCSAGWLADRSVRYPISKARPNCGG NLLGVRTVYVHANQTGYPDPSSRYDAICYTGEDFVDIPENFFGVGGEEDITVQTVTWPDMELPLPRNITEGE
Molecular weight43,73 kDa
Protein delivered with Tag?Yes
Purity estimated90%
BufferPBS, imidazole 400mM, Urea 6M, pH8 in denaturing conditions. In native conditions : PBS, DTT 1mM, pH7.4
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypePartial
Protein AccessionAAH36445.1
Spec:SwissProtIDQ6PID9
NCBI ReferenceAAH36445.1
Aliases /SynonymsAggrecan [17-392], Aggrecan, ACAN, Aggrecan core protein
ReferencePX-P1069
NoteFor research use only
Datasheet Download
MSDS Download

Publication

  • 1: Casa NL, Casa Junior AJ, Melo AV, Teodoro LS, Nascimento GR, Sousa AF,_x000D_ Flausino TC, Brito D, Bergamini R, Minasi LB, da Cruz AD, Vieira TC, Curado MP._x000D_ CASE-REPORT Association between an ACAN gene variable number tandem repeat_x000D_ polymorphism and lumbar disc herniation: a case control study. Genet Mol Res._x000D_ 2016 Dec 19;15(4). doi: 10.4238/gmr15048867. PubMed PMID: 28002585.
    • _x000D_ _x000D_ _x000D_
  • 2: Glant TT, Ocsko T, Markovics A, Szekanecz Z, Katz RS, Rauch TA, Mikecz K._x000D_ Characterization and Localization of Citrullinated Proteoglycan Aggrecan in Human_x000D_ Articular Cartilage. PLoS One. 2016 Mar 4;11(3):e0150784. doi:_x000D_ 10.1371/journal.pone.0150784. eCollection 2016. PubMed PMID: 26943656; PubMed_x000D_ Central PMCID: PMC4778950.
    • _x000D_ _x000D_ _x000D_
  • 3: Ristolainen H, Kilpivaara O, Kamper P, Taskinen M, Saarinen S, Leppä S,_x000D_ d'Amore F, Aaltonen LA. Identification of homozygous deletion in ACAN and other_x000D_ candidate variants in familial classical Hodgkin lymphoma by exome sequencing. Br_x000D_ J Haematol. 2015 Aug;170(3):428-31. doi: 10.1111/bjh.13295. Epub 2015 Feb 25._x000D_ PubMed PMID: 25715982.
    • _x000D_ _x000D_ _x000D_
  • 4: Pantazopoulos H, Markota M, Jaquet F, Ghosh D, Wallin A, Santos A, Caterson B,_x000D_ Berretta S. Aggrecan and chondroitin-6-sulfate abnormalities in schizophrenia and_x000D_ bipolar disorder: a postmortem study on the amygdala. Transl Psychiatry. 2015 Jan_x000D_ 20;5:e496. doi: 10.1038/tp.2014.128. PubMed PMID: 25603412; PubMed Central PMCID:_x000D_ PMC4312825.
    • _x000D_ _x000D_ _x000D_
  • 5: Cong L, Zhu Y, Pang H, Guanjun TU. The interaction between aggrecan gene VNTR _x000D_ polymorphism and obesity in predicting incident symptomatic lumbar disc_x000D_ herniation. Connect Tissue Res. 2014 Oct-Dec;55(5-6):384-90. doi:_x000D_ 10.3109/03008207.2014.959117. Epub 2014 Sep 22. PubMed PMID: 25188217.
    • _x000D_ _x000D_ _x000D_
  • 6: Gu J, Guan F, Guan G, Xu G, Wang X, Zhao W, Ji Y, Yan J. Aggrecan variable_x000D_ number of tandem repeat polymorphism and lumbar disc degeneration: a_x000D_ meta-analysis. Spine (Phila Pa 1976). 2013 Dec 1;38(25):E1600-7. doi:_x000D_ 10.1097/BRS.0000000000000012. PubMed PMID: 24296484.
    • _x000D_ _x000D_ _x000D_
  • 7: Hu G, Codina M, Fisher S. Multiple enhancers associated with ACAN suggest_x000D_ highly redundant transcriptional regulation in cartilage. Matrix Biol. 2012_x000D_ Jul;31(6):328-37. doi: 10.1016/j.matbio.2012.06.001. Epub 2012 Jul 20. PubMed_x000D_ PMID: 22820679; PubMed Central PMCID: PMC3508301.
    • _x000D_ _x000D_ _x000D_
  • 8: Eser O, Eser B, Cosar M, Erdogan MO, Aslan A, Yıldız H, Solak M, Haktanır A._x000D_ Short aggrecan gene repetitive alleles associated with lumbar degenerative disc_x000D_ disease in Turkish patients. Genet Mol Res. 2011 Aug 30;10(3):1923-30. doi:_x000D_ 10.4238/vol10-3gmr1222. PubMed PMID: 21948754.
    • _x000D_ _x000D_ _x000D_
  • 9: Gruber HE, Hoelscher GL, Ingram JA, Bethea S, Zinchenko N, Hanley EN Jr._x000D_ Variations in aggrecan localization and gene expression patterns characterize_x000D_ increasing stages of human intervertebral disk degeneration. Exp Mol Pathol. 2011_x000D_ Oct;91(2):534-9. doi: 10.1016/j.yexmp.2011.06.001. Epub 2011 Jun 12. PubMed PMID:_x000D_ 21689646.
    • _x000D_ _x000D_ _x000D_
  • 10: Stacey MW, Neumann SA, Dooley A, Segna K, Kelly RE, Nuss D, Kuhn AM, Goretsky_x000D_ MJ, Fecteau AH, Pastor A, Proud VK. Variable number of tandem repeat_x000D_ polymorphisms (VNTRs) in the ACAN gene associated with pectus excavatum. Clin_x000D_ Genet. 2010 Nov;78(5):502-4. doi: 10.1111/j.1399-0004.2010.01492.x. PubMed PMID: _x000D_ 21039430.
    • _x000D_ _x000D_ _x000D_
  • 11: Kim NK, Shin DA, Han IB, Yoo EH, Kim SH, Chung SS. The association of_x000D_ aggrecan gene polymorphism with the risk of intervertebral disc degeneration._x000D_ Acta Neurochir (Wien). 2011 Jan;153(1):129-33. doi: 10.1007/s00701-010-0831-2._x000D_ Epub 2010 Oct 10. PubMed PMID: 20936487.
    • _x000D_ _x000D_ _x000D_
  • 12: Jowitt TA, Murdoch AD, Baldock C, Berry R, Day JM, Hardingham TE. Order_x000D_ within disorder: aggrecan chondroitin sulphate-attachment region provides new_x000D_ structural insights into protein sequences classified as disordered. Proteins._x000D_ 2010 Dec;78(16):3317-27. doi: 10.1002/prot.22839. PubMed PMID: 20806220; PubMed_x000D_ Central PMCID: PMC3546398.
    • _x000D_ _x000D_ _x000D_
  • 13: Cong L, Pang H, Xuan D, Tu GJ. Association between the expression of aggrecan_x000D_ and the distribution of aggrecan gene variable number of tandem repeats with_x000D_ symptomatic lumbar disc herniation in Chinese Han of Northern China. Spine (Phila_x000D_ Pa 1976). 2010 Jun 15;35(14):1371-6. doi: 10.1097/BRS.0b013e3181c4e022. PubMed_x000D_ PMID: 20505571.
    • _x000D_ _x000D_ _x000D_
  • 14: Mashayekhi F, Shafiee G, Kazemi M, Dolati P. Lumbar disk degeneration disease_x000D_ and aggrecan gene polymorphism in northern Iran. Biochem Genet. 2010_x000D_ Aug;48(7-8):684-9. doi: 10.1007/s10528-010-9350-3. Epub 2010 May 23. PubMed PMID:_x000D_ 20496110.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Human Aggrecan (17-392) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.

    Cart (0 Items)

    Your cart is currently empty.

    View Products