Brand: ProteoGenix

Human 3C Protease Recombinant Enzyme (GST tag- His Tag)

PX-P1107-1000U
Quality Chart

Host species:: Escherichia coli (E.coli)
Origin species:: Homo sapiens (Human)
Molecular weight:: 47,38 kDa

€329.00

+ 329 loyalty points

Property sequence Yes

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Human 3C Protease Recombinant Enzyme (GST tag- His Tag)

Product name	Human 3C Protease Recombinant Enzyme (GST tag- His Tag)
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSGPNTEFALSLLRKN IMTITTSKGEFTGLGIHDRVCVIPTHAQPGDDVLVNGQKIRVKDKYKLVDPENINLELTVLTLDRNEKFRDIRGFISEDL EGVDATLVVHSNNFTNTILEVGPVTMAGLINLSSTPTNRMIRYDYATKTGQCGGVLCATGKIFGIHVGGNGRQGFSAQLK KQYFVEKQAAAHNHRHKH
Molecular weight	47,38 kDa
Protein delivered with Tag?	Yes
Buffer	Tris 50mMHCl pH8, NaCl 150mM, EDTA 10mM, DTT 1mM and 20% Glycerol
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Property sequence
Protein Accession	NP_740524.1
NCBI Reference	NP_740524.1
Aliases /Synonyms	#N/A
Reference	PX-P1107
Note	For research use only
Background information	Array
Molecular Constructor	Property sequence Yes

There are no reviews yet.

Be the first to review “Human 3C Protease Recombinant Enzyme (GST tag- His Tag)”

Human 3C Protease Recombinant Enzyme (GST tag- His Tag)

Human 3C Protease Recombinant Enzyme (GST tag- His Tag)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Human 3C Protease Recombinant Enzyme (GST tag- His Tag)

Specifications Human 3C Protease Recombinant Enzyme (GST tag- His Tag)

Documents

Reviews

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Human 3C Protease Recombinant Enzyme (GST tag- His Tag)