Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
  • Wide range of unique reagents
  • Free Shipping
    Free shipping in EU on Orders > €500
  • Fast worldwide delivery
    Fast worldwide delivery

Human 3C Protease Recombinant Enzyme (GST tag)

Reference: PX-P1106-1000U
size

1000U

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Escherichia coli (E. coli)

Applications

Elisa, WB

Product nameHuman 3C Protease Recombinant Enzyme (GST tag)
Origin speciesHomo sapiens (Human)
Expression systemProkaryotic expression
SequenceMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSGPNTEFALSLLRKN IMTITTSKGEFTGLGIHDRVCVIPTHAQPGDDVLVNGQKIRVKDKYKLVDPENINLELTVLTLDRNEKFRDIRGFISEDL EGVDATLVVHSNNFTNTILEVGPVTMAGLINLSSTPTNRMIRYDYATKTGQCGGVLCATGKIFGIHVGGNGRQGFSAQLK KQYFVEKQAAAS
Molecular weight46,52 kDa
Protein delivered with Tag?Yes
BufferTris-HC 50mMl pH8, NaCl 150mM, EDTA 10mM, DTT 1mM and 20% Glycerol
FormFrozen
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeProperty sequence
Protein AccessionNP_740524.1
NCBI ReferenceNP_740524.1
Aliases /SynonymsGST 3C Protease, 3C-Protease
ReferencePX-P1106
NoteFor research use only

Publication

1: Park N, Schweers NJ, Gustin KE. Selective Removal of FG Repeat Domains from the Nuclear Pore Complex by Enterovirus 2A(pro). J Virol. 2015 Nov;89(21):11069-79. doi: 10.1128/JVI.00956-15. Epub 2015 Aug 26. PubMed PMID: 26311873; PubMed Central PMCID: PMC4621107. 2: Katpally U, Fu TM, Freed DC, Casimiro DR, Smith TJ. Antibodies to the buried N terminus of rhinovirus VP4 exhibit cross-serotypic neutralization. J Virol. 2009 Jul;83(14):7040-8. doi: 10.1128/JVI.00557-09. Epub 2009 Apr 29. PubMed PMID: 19403680; PubMed Central PMCID: PMC2704786. 3: Stanway G, Hughes PJ, Mountford RC, Minor PD, Almond JW. The complete nucleotide sequence of a common cold virus: human rhinovirus 14. Nucleic Acids Res. 1984 Oct 25;12(20):7859-75. PubMed PMID: 6093056; PubMed Central PMCID: PMC320205. 4: Callahan PL, Mizutani S, Colonno RJ. Molecular cloning and complete sequence determination of RNA genome of human rhinovirus type 14. Proc Natl Acad Sci U S A. 1985 Feb;82(3):732-6. PubMed PMID: 2983312; PubMed Central PMCID: PMC397120.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Human 3C Protease Recombinant Enzyme (GST tag)”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.

    Cart (0 Items)

    Your cart is currently empty.

    View Products