Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human 3C Protease Recombinant Enzyme (GST tag)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Molecular weight:
46,52 kDa

329.00

1000U + 329 loyalty points
Property sequence Yes
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human 3C Protease Recombinant Enzyme (GST tag)

Product name Human 3C Protease Recombinant Enzyme (GST tag)
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSGPNTEFALSLLRKN IMTITTSKGEFTGLGIHDRVCVIPTHAQPGDDVLVNGQKIRVKDKYKLVDPENINLELTVLTLDRNEKFRDIRGFISEDL EGVDATLVVHSNNFTNTILEVGPVTMAGLINLSSTPTNRMIRYDYATKTGQCGGVLCATGKIFGIHVGGNGRQGFSAQLK KQYFVEKQAAAS
Molecular weight 46,52 kDa
Protein delivered with Tag? Yes
Buffer Tris-HC 50mMl pH8, NaCl 150mM, EDTA 10mM, DTT 1mM and 20% Glycerol
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Property sequence
Protein Accession NP_740524.1
NCBI Reference NP_740524.1
Aliases /Synonyms GST 3C Protease, 3C-Protease
Reference PX-P1106
Note For research use only
Molecular Constructor
Property sequence Yes

  • Park N, Schweers NJ, Gustin KE. Selective Removal of FG Repeat Domains from the Nuclear Pore Complex by Enterovirus 2A(pro). J Virol. 2015 Nov;89(21):11069-79. doi: 10.1128/JVI.00956-15. Epub 2015 Aug 26. PubMed PMID: 26311873; PubMed Central PMCID: PMC4621107.
  • Katpally U, Fu TM, Freed DC, Casimiro DR, Smith TJ. Antibodies to the buried N terminus of rhinovirus VP4 exhibit cross-serotypic neutralization. J Virol. 2009 Jul;83(14):7040-8. doi: 10.1128/JVI.00557-09. Epub 2009 Apr 29. PubMed PMID: 19403680; PubMed Central PMCID: PMC2704786.
  • Stanway G, Hughes PJ, Mountford RC, Minor PD, Almond JW. The complete nucleotide sequence of a common cold virus: human rhinovirus 14. Nucleic Acids Res. 1984 Oct 25;12(20):7859-75. PubMed PMID: 6093056; PubMed Central PMCID: PMC320205.
  • Callahan PL, Mizutani S, Colonno RJ. Molecular cloning and complete sequence determination of RNA genome of human rhinovirus type 14. Proc Natl Acad Sci U S A. 1985 Feb;82(3):732-6. PubMed PMID: 2983312; PubMed Central PMCID: PMC397120.

There are no reviews yet.

Be the first to review “Human 3C Protease Recombinant Enzyme (GST tag)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products