Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

HTLV-1 Surface protein gp46, C-Fc

Host species:
Mammalian cells
Origin species:
Human T-cell leukemia virus 1 (HTLV-1)
Uniprot ID:
P03381

Original price was: €255.00.Current price is: €228.00.

50ug 11% OFF + 228 loyalty points
Asp21–Arg312 Fc
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

HTLV-1 Surface protein gp46, C-Fc

Product name ARO-P18476-100
Uniprot ID P03381
Origin species Human T-cell leukemia virus 1 (HTLV-1)
Expression system Eukaryotic expression
Raw Antigen Sequence DYSPSCCTLTIGVSSYHSKPCNPAQPVCSWTLDLLALSADQALQPPCPNLVSYSSYHATYSLYLFPHWTKKPNRNGGGYYSASYSDPCSLKCPYLGCQSWTCPYTGAVSSPYWKFQHDVNFTQEVSRLNINLHFSKCGFPFSLLVDAPGYDPIWFLNTEPSQLPPTAPPLLPHSNLDHILEPSIPWKSKLLTLVQLTLQSTNYTCIVCIDRASLSTWHVLYSPNVSVPSSSSTPLLYPSLALPAPHLTLPFNWTHCFDPQIQAIVSSPCHNSLILPPFSLSPVPTLGSRSRR
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asp21-Arg312
Aliases /Synonyms Envelope glycoprotein gp62, Env polyprotein, Surface protein, SU, Glycoprotein 46, gp46, Transmembrane protein, TM, Glycoprotein 21, gp21, env
Reference ARO-P18476
Note For research use only.
Molecular Constructor
Asp21–Arg312 Fc
Product name ARO-P18476-1MG
Uniprot ID P03381
Origin species Human T-cell leukemia virus 1 (HTLV-1)
Expression system Eukaryotic expression
Raw Antigen Sequence DYSPSCCTLTIGVSSYHSKPCNPAQPVCSWTLDLLALSADQALQPPCPNLVSYSSYHATYSLYLFPHWTKKPNRNGGGYYSASYSDPCSLKCPYLGCQSWTCPYTGAVSSPYWKFQHDVNFTQEVSRLNINLHFSKCGFPFSLLVDAPGYDPIWFLNTEPSQLPPTAPPLLPHSNLDHILEPSIPWKSKLLTLVQLTLQSTNYTCIVCIDRASLSTWHVLYSPNVSVPSSSSTPLLYPSLALPAPHLTLPFNWTHCFDPQIQAIVSSPCHNSLILPPFSLSPVPTLGSRSRR
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asp21-Arg312
Aliases /Synonyms Envelope glycoprotein gp62, Env polyprotein, Surface protein, SU, Glycoprotein 46, gp46, Transmembrane protein, TM, Glycoprotein 21, gp21, env
Reference ARO-P18476
Note For research use only.
Molecular Constructor
Asp21–Arg312 Fc
Product name ARO-P18476-50
Uniprot ID P03381
Origin species Human T-cell leukemia virus 1 (HTLV-1)
Expression system Eukaryotic expression
Raw Antigen Sequence DYSPSCCTLTIGVSSYHSKPCNPAQPVCSWTLDLLALSADQALQPPCPNLVSYSSYHATYSLYLFPHWTKKPNRNGGGYYSASYSDPCSLKCPYLGCQSWTCPYTGAVSSPYWKFQHDVNFTQEVSRLNINLHFSKCGFPFSLLVDAPGYDPIWFLNTEPSQLPPTAPPLLPHSNLDHILEPSIPWKSKLLTLVQLTLQSTNYTCIVCIDRASLSTWHVLYSPNVSVPSSSSTPLLYPSLALPAPHLTLPFNWTHCFDPQIQAIVSSPCHNSLILPPFSLSPVPTLGSRSRR
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asp21-Arg312
Aliases /Synonyms Envelope glycoprotein gp62, Env polyprotein, Surface protein, SU, Glycoprotein 46, gp46, Transmembrane protein, TM, Glycoprotein 21, gp21, env
Reference ARO-P18476
Note For research use only.
Molecular Constructor
Asp21–Arg312 Fc

There are no reviews yet.

Be the first to review “HTLV-1 Surface protein gp46, C-Fc”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products