Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

HPeV-1 Recombinant Protein 3C, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human parechovirus 1 (HPeV-1)
Uniprot ID:
Q66578

Original price was: €283.00.Current price is: €228.00.

50ug 19% OFF + 228 loyalty points
His Ala1518–Gln1711
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

HPeV-1 Recombinant Protein 3C, N-His

Product name ARO-P18665-100
Uniprot ID Q66578
Origin species Human parechovirus 1 (HPeV-1)
Expression system Prokaryotic expression
Raw Antigen Sequence APYDGQLEHIISQMAYITGSTTGHMTHCAGYQHDEIILHGHSIKYLEQEDELTLHYKNKVFPIEQPSVTQVTLGGKPMDLAILKCKLPFRFKKNSKYYTNKIGTESMLIWMTEQGIITKEVQRVHHSGGIKTREGTESTKTISYTVKSCKGMCGGLLISKVEGNFKILGMHIAGNGEMGVAIPFNFLKNDMSDQ
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala1518-Gln1711
Aliases /Synonyms Genome polyprotein, Capsid protein VP0, P1AB, Virion protein 0, Capsid protein VP3, P1C, Virion protein 3, Capsid protein VP1, P1D, Virion protein 1, Protein 2A H-NC, P2A, Protein 2A, Protein 2B, P2B, Protein 2C, P2C, 3.6.1.15, Protein 3A, P3A, Viral protein genome-linked, VPg, Protein 3B, P3B, Protease 3C, P3C, 3.4.22.28, Picornain 3C, RNA-directed RNA polymerase 3D-POL, P3D-POL, 2.7.7.48
Reference ARO-P18665
Note For research use only.
Molecular Constructor
His Ala1518–Gln1711
Product name ARO-P18665-1MG
Uniprot ID Q66578
Origin species Human parechovirus 1 (HPeV-1)
Expression system Prokaryotic expression
Raw Antigen Sequence APYDGQLEHIISQMAYITGSTTGHMTHCAGYQHDEIILHGHSIKYLEQEDELTLHYKNKVFPIEQPSVTQVTLGGKPMDLAILKCKLPFRFKKNSKYYTNKIGTESMLIWMTEQGIITKEVQRVHHSGGIKTREGTESTKTISYTVKSCKGMCGGLLISKVEGNFKILGMHIAGNGEMGVAIPFNFLKNDMSDQ
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala1518-Gln1711
Aliases /Synonyms Genome polyprotein, Capsid protein VP0, P1AB, Virion protein 0, Capsid protein VP3, P1C, Virion protein 3, Capsid protein VP1, P1D, Virion protein 1, Protein 2A H-NC, P2A, Protein 2A, Protein 2B, P2B, Protein 2C, P2C, 3.6.1.15, Protein 3A, P3A, Viral protein genome-linked, VPg, Protein 3B, P3B, Protease 3C, P3C, 3.4.22.28, Picornain 3C, RNA-directed RNA polymerase 3D-POL, P3D-POL, 2.7.7.48
Reference ARO-P18665
Note For research use only.
Molecular Constructor
His Ala1518–Gln1711
Product name ARO-P18665-50
Uniprot ID Q66578
Origin species Human parechovirus 1 (HPeV-1)
Expression system Prokaryotic expression
Raw Antigen Sequence APYDGQLEHIISQMAYITGSTTGHMTHCAGYQHDEIILHGHSIKYLEQEDELTLHYKNKVFPIEQPSVTQVTLGGKPMDLAILKCKLPFRFKKNSKYYTNKIGTESMLIWMTEQGIITKEVQRVHHSGGIKTREGTESTKTISYTVKSCKGMCGGLLISKVEGNFKILGMHIAGNGEMGVAIPFNFLKNDMSDQ
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala1518-Gln1711
Aliases /Synonyms Genome polyprotein, Capsid protein VP0, P1AB, Virion protein 0, Capsid protein VP3, P1C, Virion protein 3, Capsid protein VP1, P1D, Virion protein 1, Protein 2A H-NC, P2A, Protein 2A, Protein 2B, P2B, Protein 2C, P2C, 3.6.1.15, Protein 3A, P3A, Viral protein genome-linked, VPg, Protein 3B, P3B, Protease 3C, P3C, 3.4.22.28, Picornain 3C, RNA-directed RNA polymerase 3D-POL, P3D-POL, 2.7.7.48
Reference ARO-P18665
Note For research use only.
Molecular Constructor
His Ala1518–Gln1711

There are no reviews yet.

Be the first to review “HPeV-1 Recombinant Protein 3C, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products