Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Horse P47 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Horse
Uniprot ID:
F5CEP2
Molecular weight:
42,15 kDa

210.00

50ug + 210 loyalty points
Partial Yes
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Horse P47 Recombinant Protein

Product name Horse P47 Recombinant Protein
Uniprot ID F5CEP2
Uniprot link http://www.uniprot.org/uniprot/F5CEP2
Origin species Horse
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLASGPCFPNPCQNDGECHVIDDSHRGDVFTQYICSCPRGYTGTHCETTCAMPLGMETGAIADAQISASSV YFGFMGLQRWVPELARLHRTGIVNAWTASNYDKNPWIQVNLMRKMRVTGVVTQGASRGGTAEYLKTFKVAYSVDGRKFQF IRDAGDSKDKVFVGNVDNSGLKVNMFDVPLEVQYVRLVPVACHHGCTLRFELLGCEVNGCAEPLGLEDNSIPDRQITASS TYRTWGLNAFSWYPFYARLDKQGKFNAWTAQSNSASEWLQVDLGSQKQVTGVVTQGARDFGHIQYVAAYKVSHSNDGANW TEYRDQRAADSKIFPGNLDNNSHKKNMFETPFLARFVRILPVAWHNRITLRVELLGC
Molecular weight 42,15 kDa
Protein delivered with Tag? Yes
Purity estimated 70%
Buffer PBS, imidazole 200mM, Urea 8M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AEC32944.1
Spec:SwissProtID F5CEP2
NCBI Reference AEC32944.1
Aliases /Synonyms P47, milk fat globule-EGF factor 8 splice variant, partial
Reference PX-P1055
Note For research use only
Molecular Constructor
Partial Yes
Product name Horse P47 Recombinant Protein
Uniprot ID F5CEP2
Uniprot link http://www.uniprot.org/uniprot/F5CEP2
Origin species Horse
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLASGPCFPNPCQNDGECHVIDDSHRGDVFTQYICSCPRGYTGTHCETTCAMPLGMETGAIADAQISASSV YFGFMGLQRWVPELARLHRTGIVNAWTASNYDKNPWIQVNLMRKMRVTGVVTQGASRGGTAEYLKTFKVAYSVDGRKFQF IRDAGDSKDKVFVGNVDNSGLKVNMFDVPLEVQYVRLVPVACHHGCTLRFELLGCEVNGCAEPLGLEDNSIPDRQITASS TYRTWGLNAFSWYPFYARLDKQGKFNAWTAQSNSASEWLQVDLGSQKQVTGVVTQGARDFGHIQYVAAYKVSHSNDGANW TEYRDQRAADSKIFPGNLDNNSHKKNMFETPFLARFVRILPVAWHNRITLRVELLGC
Molecular weight 42,15 kDa
Protein delivered with Tag? Yes
Purity estimated 70%
Buffer PBS, imidazole 200mM, Urea 8M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AEC32944.1
Spec:SwissProtID F5CEP2
NCBI Reference AEC32944.1
Aliases /Synonyms P47, milk fat globule-EGF factor 8 splice variant, partial
Reference PX-P1055
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Horse P47 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products