Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Histone H3.1(HIST1H3A) |
---|---|
Uniprot ID | P68431/Q6LED0/Q6LBF0/P68433 |
Uniprot link | https://www.uniprot.org/uniprot/P68431 |
Origin species | General |
Expression system | Prokaryotic expression |
Sequence | MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA |
Molecular weight | 16.47kDa |
Protein delivered with Tag? | C-terminal His Tag |
Purity estimated | >95% by SDS-PAGE |
Buffer | PBS pH 7.5 |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Met1~Ala136 |
Protein Accession | P68431 |
Spec:Entrez GeneID | 8350 |
Spec:NCBI Gene Aliases | H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A |
NCBI Reference | P68431 |
Aliases /Synonyms | H3FJ |
Reference | PX-P4575 |
Note | For research use only |
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.