Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Growth/differentiation factor 11(GDF11)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Growth/differentiation factor 11(GDF11) |
|---|---|
| Uniprot ID | O95390 |
| Uniprot link | https://www.uniprot.org/uniprot/O95390 |
| Expression system | Prokaryotic expression |
| Sequence | MGSHHHHHHSGNLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAG PCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS |
| Molecular weight | 13.7kDa |
| Protein delivered with Tag? | N-terminal His Tag |
| Purity estimated | >70% by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Asn299-Ser407 |
| Protein Accession | O95390 |
| Spec:Entrez GeneID | 10220 |
| Spec:NCBI Gene Aliases | VHO; BMP11; BMP-11 |
| NCBI Reference | O95390 |
| Aliases /Synonyms | Bone morphogenetic protein 11,Bone morphogenetic protein 11,BMP-11,BMP11 |
| Reference | PX-P4823 |
| Note | For research use only |
Related products
Tag Antibody
Anti His tag mouse monoclonal antibody
PTX17851 180€Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.