Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Granulocyte-macrophage colony-stimulating factor receptor subunit alpha(CSF2RA)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Granulocyte-macrophage colony-stimulating factor receptor subunit alpha(CSF2RA) |
|---|---|
| Uniprot ID | P15509 |
| Uniprot link | https://www.uniprot.org/uniprot/P15509 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG |
| Molecular weight | 60 kDa（36.91 kDa) |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >95% by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1-Gly320 |
| Protein Accession | P15509 |
| Spec:Entrez GeneID | 1438 |
| Spec:NCBI Gene Aliases | GMR; CD116; CSF2R; SMDP4; CDw116; CSF2RX; CSF2RY; GMCSFR; CSF2RAX; CSF2RAY; alphaGMR; GMR-alpha; GMCSFR-alpha; GM-CSF-R-alpha |
| Spec:SwissProtID | Q16564 |
| NCBI Reference | P15509 |
| Aliases /Synonyms | CSF2R, CSF2RY,GM-CSF-R-alpha，GMCSFR-alpha，GMR-alpha，CDw116，CD116 |
| Reference | PX-P4584 |
| Note | For research use only |
Related products
Biosimilar
Mavrilimumab Biosimilar – Anti-CSF2RA, CD116 mAb – Research Grade
PX-TA1241 200€
Tag Antibody
Anti His tag mouse monoclonal antibody
PTX17851 180€Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.