Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
  • Wide range of unique reagents
  • Free Shipping
    Free shipping in EU on Orders > €500
  • Fast worldwide delivery
    Fast worldwide delivery

Elizabethkingia miricola PNGaseF Recombinant Protein

Reference:

Active

3 reviews Write a review
size

15000u, 75000u, 50ug, 100ug

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Escherichia coli (E. coli)

Applications

Elisa, WB

Product nameElizabethkingia miricola PNGaseF Recombinant Protein
Uniprot IDP21163
Uniprot linkhttp://www.uniprot.org/uniprot/P21163
Origin speciesSchizosaccharomyces pombe
Expression systemProkaryotic expression
SequenceMAHNHRHKHKLSVHSDNQSQISIEVGRDAPAAAATDLSGIIGPQMTKSPASSVTHFSTPSMLPIGGTSLDDELLAPVDDL NLDLGLDDLLGDEQGANAPAIEADEQAETSSIHLPSDIMEDDSSRPAAAGVEEGQVVESATAPQQEKINPQKTVRRQRAI IDPVTELSSKQMKKQLADTSSITSPLCLNTSSIVFNATVNFTRNGKFNTSIFSSNLNPKVNELLQADFKQAILRKRKNES PEEVEPAKHQRTDTSTENQETAEVLDPEEIAAAELANITEAAIATLPQETVVQPEGEAPELGSPMGFPVTALESADDSLF DAPPVMLDEADLLGSERLDSSVSEALPSSQTAKDSLRNKWDPYTEGEKVSFQTLSAGCNREEAVQLFFDVLVLATKDVIS VKQDVAIQNEITLTAKRGMLLSSL
Molecular weight45,52 kDa
Purity estimated90%
BufferPBS, imidazole 300mM
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypePartial
NCBI ReferenceNP_588151.1
Aliases /SynonymsPeptide -N-Glycosidase F, PNGase F, PNGaseF
ReferencePX-P3070
NoteFor research use only

Description of Elizabethkingia miricola PNGaseF Recombinant Protein

General information on Elizabethkingia miricola PNGaseF Recombinant Protein-15000u

PNGase F is a recombinant glycosidase cloned from Elizabethkingia miricola and overexpressed in E. coli. It cleaves a complete glycan from a glycoprotein and it deaminates the asparagine to aspartic acid, but leaves the oligosaccharide undamaged. PNGase F will not eliminate oligosaccharides containing Alpha-(1, 3)-linked core fucose usually found in plant glycoproteins. A tri-peptide with the oligosaccharide-linked asparagine as the central residue is the minimal substrate for PNGase F.

Publication

  • 1: Kuhn P, Tarentino AL, Plummer TH Jr, Van Roey P. Crystal structure of peptide-N4-(N-acetyl-beta-D-glucosaminyl)asparagine amidase F at 2.2-A resolution. Biochemistry. 1994 Oct 4;33(39):11699-706. PubMed PMID: 7918386.
  • 2: Norris GE, Stillman TJ, Anderson BF, Baker EN. The three-dimensional structure of PNGase F, a glycosylasparaginase from Flavobacterium meningosepticum. Structure. 1994 Nov 15;2(11):1049-59. PubMed PMID: 7881905.
  • 3: Kuhn P, Guan C, Cui T, Tarentino AL, Plummer TH Jr, Van Roey P. Active site and oligosaccharide recognition residues of peptide-N4-(N-acetyl-beta-D-glucosaminyl)asparagine amidase F. J Biol Chem. 1995 Dec 8;270(49):29493-7. PubMed PMID: 7493989.
  • 4: Lemp D, Haselbeck A, Klebl F. Molecular cloning and heterologous expression of N-glycosidase F from Flavobacterium meningosepticum. J Biol Chem. 1990 Sep 15;265(26):15606-10. PubMed PMID: 2203781.
  • 5: Barsomian GD, Johnson TL, Borowski M, Denman J, Ollington JF, Hirani S, McNeilly DS, Rasmussen JR. Cloning and expression of peptide-N4-(N-acetyl-beta-D-glucosaminyl)asparagine amidase F in Escherichia coli. J Biol Chem. 1990 Apr 25;265(12):6967-72. PubMed PMID: 2182635.
  • 6: Tarentino AL, Quinones G, Trumble A, Changchien LM, Duceman B, Maley F, Plummer TH Jr. Molecular cloning and amino acid sequence of peptide-N4-(N-acetyl-beta-D-glucosaminyl)asparagine amidase from flavobacterium meningosepticum. J Biol Chem. 1990 Apr 25;265(12):6961-6. Erratum in: J Biol Chem 1990 Jul 5;265(19):11405. PubMed PMID: 2182634.

Reviews

  • Waltteri Hosia

    Was the protein active?: Yes

    Very good product. I would buy again.

  • Waltteri Hosia

    Was the protein active?: Yes

    Very good product. I would buy again.

  • Waltteri Hosia

    Was the protein active?: Yes

    Very good product. I would buy again.

REVIEW YOUR PRODUCT

Add a review

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.

    Cart (0 Items)

    Your cart is currently empty.

    View Products