Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Cytochrome c oxidase assembly factor 8(COA8) |
---|---|
Uniprot ID | Q96IL0 |
Uniprot link | https://www.uniprot.org/uniprot/Q96IL0 |
Expression system | Prokaryotic expression |
Sequence | MGSHHHHHHSGAPERGAERRDTAPSGVSRFCPPRKSCHDWIGPPDKYSNLRPVHFYIPENESPLEQKLRKLRQETQEWNQQFWANQNLTFSKEKEEFIHSRLKTKGLGLRTESGQKATLNAEEMADFYKEFLSKNFQKHMYYNRDWYKRNFAITFFMGKVALERIWNKLKQKQKKRSN |
Molecular weight | 21.3kDa |
Protein delivered with Tag? | N-terminal His Tag |
Purity estimated | >90% by SDS-PAGE |
Buffer | PBS, pH7.5 |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Ala40-Asn206 |
Protein Accession | Q96IL0 |
Spec:Entrez GeneID | 84334 |
Spec:NCBI Gene Aliases | APOP; APOP1; APOPT1; MC4DN17; C14orf153 |
Spec:SwissProtID | Q53G28 |
NCBI Reference | Q96IL0 |
Aliases /Synonyms | APOP1, APOPT1,APOP-1,Apoptogenic protein 1, mitochondrial |
Reference | PX-P4817 |
Note | For research use only |
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.