Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Cyclin-dependent kinase inhibitor 2A(CDKN2A)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P42771
Molecular weight:
17.74kDa

Original price was: €256.00.Current price is: €210.00.

50ug 18% OFF + 210 loyalty points
full length
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Cyclin-dependent kinase inhibitor 2A(CDKN2A)

Product name Cyclin-dependent kinase inhibitor 2A(CDKN2A)
Uniprot ID P42771
Uniprot link http://www.uniprot.org/uniprot/P42771
Expression system Prokaryotic expression
Raw Antigen Sequence MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
Molecular weight 17.74kDa
Purity estimated 85% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type full length
Aliases /Synonyms Cyclin-dependent kinase 4 inhibitor A, CDK4I, Multiple tumor suppressor 1, MTS-1, p16-INK4a, p16-INK4, p16INK4A
Reference PX-P4534
Note For research use only
Molecular Constructor
full length
Product name Cyclin-dependent kinase inhibitor 2A(CDKN2A)
Uniprot ID P42771
Uniprot link http://www.uniprot.org/uniprot/P42771
Expression system Prokaryotic expression
Raw Antigen Sequence MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
Molecular weight 17.74kDa
Purity estimated 85% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type full length
Aliases /Synonyms Cyclin-dependent kinase 4 inhibitor A, CDK4I, Multiple tumor suppressor 1, MTS-1, p16-INK4a, p16-INK4, p16INK4A
Reference PX-P4534
Note For research use only
Molecular Constructor
full length
Product name PX-P4534-1MG
Uniprot ID P42771
Uniprot link http://www.uniprot.org/uniprot/P42771
Expression system Prokaryotic expression
Raw Antigen Sequence MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
Molecular weight 17.74kDa
Purity estimated 85% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type full length
Aliases /Synonyms Cyclin-dependent kinase 4 inhibitor A, CDK4I, Multiple tumor suppressor 1, MTS-1, p16-INK4a, p16-INK4, p16INK4A
Reference PX-P4534
Note For research use only
Molecular Constructor
full length

General Information about Cyclin-dependent kinase inhibitor 2A(CDKN2A)

CDKN2A, also known as cyclin-dependent kinase inhibitor 2A, is a gene on human chromosome 9 p21.3. By strongly interacting with CDK4 and CDK6, it acts as a negative regulator of normal cell proliferation. This inhibits their ability to interact with cyclin D and phosphorylate retinoblastoma proteins.

Cyclin-dependent kinase inhibitor 2A(CDKN2A)

There are no reviews yet.

Be the first to review “Cyclin-dependent kinase inhibitor 2A(CDKN2A)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products