Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
  • Wide range of unique reagents
  • Free Shipping
    Free shipping in EU on Orders > €500
  • Fast worldwide delivery
    Fast worldwide delivery

Cyclin-dependent kinase inhibitor 2A(CDKN2A)

Reference:
size

100ug, 50ug

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Escherichia coli (E. coli)

Applications

Elisa, WB

Product nameCyclin-dependent kinase inhibitor 2A(CDKN2A)
Uniprot IDP42771
Uniprot linkhttp://www.uniprot.org/uniprot/P42771
Expression systemProkaryotic expression
SequenceMGSHHHHHHSGMEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAE PNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAE GPSDIPD
Molecular weight17.74kDa
Purity estimated85% by SDS-PAGE
BufferPBS, pH7.5
Delivery conditionDry Ice
Delivery lead time in business daysEurope: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment Typefull length
Aliases /SynonymsCyclin-dependent kinase 4 inhibitor A, CDK4I, Multiple tumor suppressor 1, MTS-1, p16-INK4a, p16-INK4, p16INK4A
ReferencePX-P4534
NoteFor research use only

Description of Cyclin-dependent kinase inhibitor 2A(CDKN2A)

General Information about Cyclin-dependent kinase inhibitor 2A(CDKN2A)

CDKN2A, also known as cyclin-dependent kinase inhibitor 2A, is a gene on human chromosome 9 p21.3. By strongly interacting with CDK4 and CDK6, it acts as a negative regulator of normal cell proliferation. This inhibits their ability to interact with cyclin D and phosphorylate retinoblastoma proteins.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Cyclin-dependent kinase inhibitor 2A(CDKN2A)”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.

    Cart (0 Items)

    Your cart is currently empty.

    View Products