Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Cow PAG1B Recombinant Protein (Partial)

Host species:
Escherichia coli (E.coli)
Origin species:
Bos taurus
Uniprot ID:
Q29432
Molecular weight:
38,07kDa

210.00

50ug + 210 loyalty points
Partial C-Ter His
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Cow PAG1B Recombinant Protein (Partial)

Product name Cow PAG1B Recombinant Protein (Partial)
Uniprot ID Q29432
Origin species Bos taurus
Expression system Prokaryotic expression
Raw Antigen Sequence MGSRGSNLTTHPLRNIKDLVYMGNITIGTPPQEFQVVFDTASSDLWVPSDFCTSPACSTHVRFRHLQSSTFR LTNKTFRITYGSGRMKGVVVHDTVRIGNLVSTDQPFGLSIEEYGFEGRIYDGVLGLNYPNISFSGAIPIFDK LKNQRAISEPVFAFYLSKDEREGSVVMFGGVDHRYYEGELNWVPLIQAGDWSVHMDRISIERKIIACSDGCK ALVDTGTSDIVGPRRLVNNIHRLIGAIPRGSEHYVPCSEVNTLPSIVFTINGINYPVPGRAYILKDDRGRCY TTFQENRVSSSTETWYLGDVFLRLYFSVFDRGNDRIGLARAVLEHHHHHH
Molecular weight 38,07kDa
Protein delivered with Tag? C-Ter His Tag
Purity estimated 0,9
Buffer PBS pH 7.5, 0.02% SKL
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Reference PX-P4898
Note For research use only
Molecular Constructor
Partial C-Ter His
Product name Cow PAG1B Recombinant Protein (Partial)
Uniprot ID Q29432
Origin species Bos taurus
Expression system Prokaryotic expression
Raw Antigen Sequence MGSRGSNLTTHPLRNIKDLVYMGNITIGTPPQEFQVVFDTASSDLWVPSDFCTSPACSTHVRFRHLQSSTFR LTNKTFRITYGSGRMKGVVVHDTVRIGNLVSTDQPFGLSIEEYGFEGRIYDGVLGLNYPNISFSGAIPIFDK LKNQRAISEPVFAFYLSKDEREGSVVMFGGVDHRYYEGELNWVPLIQAGDWSVHMDRISIERKIIACSDGCK ALVDTGTSDIVGPRRLVNNIHRLIGAIPRGSEHYVPCSEVNTLPSIVFTINGINYPVPGRAYILKDDRGRCY TTFQENRVSSSTETWYLGDVFLRLYFSVFDRGNDRIGLARAVLEHHHHHH
Molecular weight 38,07kDa
Protein delivered with Tag? C-Ter His Tag
Purity estimated 0,9
Buffer PBS pH 7.5, 0.02% SKL
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Reference PX-P4898
Note For research use only
Molecular Constructor
Partial C-Ter His

Cow PAG1B Recombinant Protein (Partial)

There are no reviews yet.

Be the first to review “Cow PAG1B Recombinant Protein (Partial)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products