Cow PAG1B Recombinant Protein (Partial)

Reference:
Product nameCow PAG1B Recombinant Protein (Partial)
Uniprot IDQ29432
Origin speciesBos taurus
Expression systemProkaryotic expression
SequenceMGSRGSNLTTHPLRNIKDLVYMGNITIGTPPQEFQVVFDTASSDLWVPSDFCTSPACSTHVRFRHLQSSTFR LTNKTFRITYGSGRMKGVVVHDTVRIGNLVSTDQPFGLSIEEYGFEGRIYDGVLGLNYPNISFSGAIPIFDK LKNQRAISEPVFAFYLSKDEREGSVVMFGGVDHRYYEGELNWVPLIQAGDWSVHMDRISIERKIIACSDGCK ALVDTGTSDIVGPRRLVNNIHRLIGAIPRGSEHYVPCSEVNTLPSIVFTINGINYPVPGRAYILKDDRGRCY TTFQENRVSSSTETWYLGDVFLRLYFSVFDRGNDRIGLARAVLEHHHHHH
Molecular weight38,07kDa
Protein delivered with Tag?C-Ter His Tag
Purity estimated90%
BufferPBS pH 7.5, 0.02% SKL
Formliquid
Delivery conditionDry Ice
Delivery lead time in business daysEurope: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypePartial
ReferencePX-P4898
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Cow PAG1B Recombinant Protein (Partial)”

Your email address will not be published. Required fields are marked *

Related products

Anti His tag mouse monoclonal antibody
Tag Antibody Anti His tag mouse monoclonal antibody PTX17851-100 180€

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.