Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Cow PAG1B Recombinant Protein (Partial)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Cow PAG1B Recombinant Protein (Partial) |
|---|---|
| Uniprot ID | Q29432 |
| Origin species | Bos taurus |
| Expression system | Prokaryotic expression |
| Sequence | MGSRGSNLTTHPLRNIKDLVYMGNITIGTPPQEFQVVFDTASSDLWVPSDFCTSPACSTHVRFRHLQSSTFR LTNKTFRITYGSGRMKGVVVHDTVRIGNLVSTDQPFGLSIEEYGFEGRIYDGVLGLNYPNISFSGAIPIFDK LKNQRAISEPVFAFYLSKDEREGSVVMFGGVDHRYYEGELNWVPLIQAGDWSVHMDRISIERKIIACSDGCK ALVDTGTSDIVGPRRLVNNIHRLIGAIPRGSEHYVPCSEVNTLPSIVFTINGINYPVPGRAYILKDDRGRCY TTFQENRVSSSTETWYLGDVFLRLYFSVFDRGNDRIGLARAVLEHHHHHH |
| Molecular weight | 38,07kDa |
| Protein delivered with Tag? | C-Ter His Tag |
| Purity estimated | 0,9 |
| Buffer | PBS pH 7.5, 0.02% SKL |
| Form | liquid |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| Reference | PX-P4898 |
| Note | For research use only |
Related products
Tag Antibody
Anti His tag mouse monoclonal antibody
PTX17851 180€Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.