Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Conbercept Biosimilar – Anti-VEGFA fusion protein – Research Grade

Uniprot ID:
P15692

Original price was: €189.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Conbercept Biosimilar - Anti-VEGFA fusion protein - Research Grade

Product name Conbercept Biosimilar - Anti-VEGFA fusion protein - Research Grade
Uniprot ID P15692
Expression system XtenCHO
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-Vascular endothelial growth factor A, VPF, VEGFA, VEGF, Vascular permeability factor, VEGF-A
Reference PX-TA2007
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [FLT1 (fms-related tyrosine kinase 1, vascular endothelial growth factor receptor 1, VEGFR-1, VEGFR, FLT, FRT, vascular permeability factor receptor) - KDR (kinase insert domain receptor, vascular endothelial growth factor receptor 2, VEGFR2, VEGF-R2, FLK1, CD309)]2 - IGHG1 Fc (Fragment constant)
Product name Conbercept Biosimilar - Anti-VEGFA fusion protein - Research Grade
Uniprot ID P15692
Expression system XtenCHO
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-Vascular endothelial growth factor A, VPF, VEGFA, VEGF, Vascular permeability factor, VEGF-A
Reference PX-TA2007
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [FLT1 (fms-related tyrosine kinase 1, vascular endothelial growth factor receptor 1, VEGFR-1, VEGFR, FLT, FRT, vascular permeability factor receptor) - KDR (kinase insert domain receptor, vascular endothelial growth factor receptor 2, VEGFR2, VEGF-R2, FLK1, CD309)]2 - IGHG1 Fc (Fragment constant)
Product name PX-TA2007-50
Uniprot ID P15692
Expression system XtenCHO
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Vascular endothelial growth factor A, VPF, VEGFA, VEGF, Vascular permeability factor, VEGF-A
Reference PX-TA2007
Note For research use only. Not suitable for human use.
Isotype Fusion - [FLT1 (fms-related tyrosine kinase 1, vascular endothelial growth factor receptor 1, VEGFR-1, VEGFR, FLT, FRT, vascular permeability factor receptor) - KDR (kinase insert domain receptor, vascular endothelial growth factor receptor 2, VEGFR2, VEGF-R2, FLK1, CD309)]2 - IGHG1 Fc (Fragment constant)

Introduction

Conbercept Biosimilar is a research grade anti-VEGFA fusion protein that has shown promising results in the treatment of various diseases. This novel therapeutic agent is derived from the fusion of two anti-VEGFA antibodies, making it a unique and powerful treatment option for diseases associated with abnormal angiogenesis.

Structure of Conbercept Biosimilar

Conbercept Biosimilar is a fusion protein composed of two distinct anti-VEGFA antibodies, each with a different binding affinity and specificity towards VEGFA. The first antibody, derived from the humanized monoclonal antibody bevacizumab, binds to the VEGFA receptor and inhibits its activity. The second antibody, derived from the monoclonal antibody ranibizumab, binds to the VEGFA ligand and prevents its interaction with the receptor. This dual mechanism of action makes Conbercept Biosimilar a potent inhibitor of VEGFA signaling.

Activity of Conbercept Biosimilar

The main activity of Conbercept Biosimilar is its ability to inhibit VEGFA signaling. VEGFA is a key mediator of angiogenesis, the process by which new blood vessels are formed. This process is essential for tissue growth and repair, but it can also contribute to the development of diseases such as cancer, age-related macular degeneration, and diabetic retinopathy. By blocking VEGFA signaling, Conbercept Biosimilar can effectively inhibit the growth of new blood vessels, thereby preventing the progression of these diseases.

Application of Conbercept Biosimilar

Conbercept Biosimilar has shown promising results in the treatment of various diseases associated with abnormal angiogenesis. Its main application is in the treatment of neovascular age-related macular degeneration (nAMD), a leading cause of blindness in the elderly population. In clinical trials, Conbercept Biosimilar has demonstrated superior efficacy compared to other anti-VEGFA therapies, with a longer duration of action and fewer injections required.

In addition to nAMD, Conbercept Biosimilar has also shown potential in the treatment of diabetic macular edema (DME) and diabetic retinopathy. These conditions are characterized by abnormal angiogenesis in the retina, leading to vision loss. By inhibiting VEGFA signaling, Conbercept Biosimilar can reduce the leakage of blood and fluid into the retina, improving vision and preventing further damage.

Furthermore, Conbercept Biosimilar has also been investigated as a potential treatment for various cancers, including colorectal, lung, and breast cancer. VEGFA is known to play a crucial role in tumor growth and metastasis, and by targeting this pathway, Conbercept Biosimilar has the potential to slow down or even halt the progression of these cancers.

Conclusion

In summary, Conbercept Biosimilar is a novel anti-VEGFA fusion protein that has shown promising results in the treatment of various diseases associated with abnormal angiogenesis. Its unique structure and dual mechanism of action make it a potent inhibitor of VEGFA signaling, making it a promising therapeutic option for a wide range of diseases. Further research and clinical trials are needed to fully explore the potential of Conbercept Biosimilar in the treatment of these diseases.

Conbercept Biosimilar - Anti-VEGFA fusion protein binds to VEGFA / VEGF165, C-His, recombinant protein in indirect ELISA Assay

Conbercept Biosimilar - Anti-VEGFA fusion protein binds to VEGFA / VEGF165, C-His, recombinant protein in indirect ELISA Assay

Immobilized VEGFA / VEGF165, C-His, recombinant protein (cat. No.PX-P5977) at 0.5µg/mL (100µL/well) can bind to Conbercept Biosimilar - Anti-VEGFA fusion protein (cat. No.PX-TA2007) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Conbercept Biosimilar - Anti-VEGFA fusion protein - Research Grade

There are no reviews yet.

Be the first to review “Conbercept Biosimilar – Anti-VEGFA fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products